BLASTX nr result
ID: Cocculus23_contig00045718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00045718 (215 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79019.1| hypothetical protein VITISV_043767 [Vitis vinifera] 42 2e-06 >emb|CAN79019.1| hypothetical protein VITISV_043767 [Vitis vinifera] Length = 1070 Score = 42.4 bits (98), Expect(2) = 2e-06 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +1 Query: 16 WVSPRDCKDIFHRDYVG-SRSKRKRAIWNISILAILWFIWKE--CKIFREQ 159 WV PR D+ +Y G +SKR +W + +A++W +W+E +IF+++ Sbjct: 973 WVPPRSISDLITINYKGFGKSKRSIVLWQTACIALIWVVWRERNARIFKDK 1023 Score = 35.0 bits (79), Expect(2) = 2e-06 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +2 Query: 134 RNARYFENKETNPESLWEYMHYKISLW 214 RNAR F++K N E+LW+ +H+ S W Sbjct: 1015 RNARIFKDKVRNSENLWDTIHFLASFW 1041