BLASTX nr result
ID: Cocculus23_contig00045567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00045567 (231 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003853725.1| hypothetical protein MYCGRDRAFT_69529 [Zymos... 71 2e-10 gb|EME84170.1| hypothetical protein MYCFIDRAFT_163010 [Pseudocer... 69 9e-10 gb|EMC98280.1| hypothetical protein BAUCODRAFT_67635 [Baudoinia ... 67 3e-09 gb|EMF10424.1| kinase-like protein [Sphaerulina musiva SO2202] 67 3e-09 gb|EME45782.1| hypothetical protein DOTSEDRAFT_71462 [Dothistrom... 60 2e-07 >ref|XP_003853725.1| hypothetical protein MYCGRDRAFT_69529 [Zymoseptoria tritici IPO323] gi|339473608|gb|EGP88701.1| hypothetical protein MYCGRDRAFT_69529 [Zymoseptoria tritici IPO323] Length = 607 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = +1 Query: 88 SPAHAFLSSWSRGDAFEEAVSSPDPDDEGQPVGLNGEFIVGRTLGKGG 231 SPAHAFLSSW+R DA EA P PDDEGQ +GL EF++GRT+ KGG Sbjct: 246 SPAHAFLSSWARADA--EAAPEPKPDDEGQSIGLENEFVIGRTISKGG 291 >gb|EME84170.1| hypothetical protein MYCFIDRAFT_163010 [Pseudocercospora fijiensis CIRAD86] Length = 606 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = +1 Query: 85 ISPAHAFLSSWSRGDAFEEAVSSPDPDDEGQPVGLNGEFIVGRTLGKGG 231 +SPAHAFL++W +GD E A S PDDEGQ +GLN E+I+GRTL +GG Sbjct: 243 VSPAHAFLANWGKGDVEENATESK-PDDEGQSIGLNNEYIIGRTLNRGG 290 >gb|EMC98280.1| hypothetical protein BAUCODRAFT_67635 [Baudoinia compniacensis UAMH 10762] Length = 438 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = +1 Query: 88 SPAHAFLSSWSRGDAFEEAVSSPDPDDEGQPVGLNGEFIVGRTLGKGG 231 SPA AFLSSW+ G E VS P PDDEGQ +G N E+IVGRT+ +GG Sbjct: 80 SPAQAFLSSWTTGALSAEPVSDPKPDDEGQAIGFNNEYIVGRTINQGG 127 >gb|EMF10424.1| kinase-like protein [Sphaerulina musiva SO2202] Length = 604 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = +1 Query: 85 ISPAHAFLSSWSRGDAFEEAVSSPDPDDEGQPVGLNGEFIVGRTLGKGG 231 +SPAHAFL++W +GDA EE P PDDEGQ +GLN E+I+GR + +GG Sbjct: 241 LSPAHAFLANWGKGDA-EEMPPEPKPDDEGQAIGLNCEYIIGRLISRGG 288 >gb|EME45782.1| hypothetical protein DOTSEDRAFT_71462 [Dothistroma septosporum NZE10] Length = 601 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = +1 Query: 88 SPAHAFLSSWSRGDAFEEAVSSPDPDDEGQPVGLNGEFIVGRTLGKGG 231 SPA AFLS W R EE P PDDEGQ VGLN E+++GRT+ +GG Sbjct: 241 SPAQAFLSGWGRT---EEPPPEPKPDDEGQSVGLNNEYVIGRTINRGG 285