BLASTX nr result
ID: Cocculus23_contig00044549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00044549 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008802509.1| ribosomal protein S4 (mitochondrion) [Asclep... 79 5e-13 ref|YP_005090486.1| ribosomal protein S4 (mitochondrion) [Lotus ... 79 5e-13 ref|YP_005090450.1| ribosomal protein S4 (mitochondrion) [Millet... 79 5e-13 ref|YP_002000578.1| ribosomal protein S4 [Oryza sativa Japonica ... 79 5e-13 dbj|BAD83538.2| ribosomal protein S4, partial (mitochondrion) [N... 77 3e-12 ref|YP_717175.1| ribosomal protein S4 [Brassica napus] gi|375911... 75 1e-11 sp|Q31708.2|RT04_ARATH RecName: Full=Ribosomal protein S4, mitoc... 75 1e-11 gb|ACH78250.1| ribosomal protein S4 [Arabidopsis thaliana] 75 1e-11 ref|YP_003587235.1| ribosomal protein S4 [Citrullus lanatus] gi|... 74 2e-11 ref|YP_004222288.1| ribosomal protein S4 [Beta vulgaris subsp. m... 73 5e-11 ref|NP_064046.2| rps4 gene product (mitochondrion) [Beta vulgari... 73 5e-11 emb|CBX33388.1| ribosomal protein S4 (mitochondrion) [Malus dome... 72 1e-10 ref|XP_004500180.1| PREDICTED: ribosomal protein S4, mitochondri... 70 3e-10 gb|AGC78977.1| ribosomal protein S4 (mitochondrion) [Vicia faba] 70 3e-10 ref|YP_007889804.1| ribosomal protein S4 (mitochondrion) [Vigna ... 70 3e-10 ref|YP_007516900.1| ribosomal protein S4 (mitochondrion) [Glycin... 70 3e-10 ref|XP_003588262.1| Ribosomal protein S4 [Medicago truncatula] g... 70 3e-10 ref|YP_004222821.1| ribosomal protein S4 [Vigna radiata] gi|3082... 70 3e-10 gb|EXB66620.1| Ribosomal protein S4 [Morus notabilis] 69 5e-10 ref|YP_004237282.1| ribosomal protein S4 (mitochondrion) [Ricinu... 69 7e-10 >ref|YP_008802509.1| ribosomal protein S4 (mitochondrion) [Asclepias syriaca] gi|556562347|gb|AGZ63043.1| ribosomal protein S4 (mitochondrion) [Asclepias syriaca] Length = 274 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 1 LKAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 LKAVVFYGPNIGHIPHDIRLKDLNL LWSGNGRGQNI Sbjct: 238 LKAVVFYGPNIGHIPHDIRLKDLNLLLWSGNGRGQNI 274 >ref|YP_005090486.1| ribosomal protein S4 (mitochondrion) [Lotus japonicus] gi|357197350|gb|AET62946.1| ribosomal protein S4 (mitochondrion) [Lotus japonicus] Length = 358 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 1 LKAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 LKAVVFYGPNIGHIPHDIRLKDLNL LWSGNGRGQNI Sbjct: 322 LKAVVFYGPNIGHIPHDIRLKDLNLLLWSGNGRGQNI 358 >ref|YP_005090450.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|372450274|ref|YP_005090457.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|357197313|gb|AET62910.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|357197320|gb|AET62917.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] Length = 358 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 1 LKAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 LKAVVFYGPNIGHIPHDIRLKDLNL LWSGNGRGQNI Sbjct: 322 LKAVVFYGPNIGHIPHDIRLKDLNLLLWSGNGRGQNI 358 >ref|YP_002000578.1| ribosomal protein S4 [Oryza sativa Japonica Group] gi|92700092|dbj|BAC19883.2| Ribosomal protein S4 [Oryza sativa Japonica Group] Length = 352 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 1 LKAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 LKAVVFYGPNIGHIPHDIRLKDLNL LWSGNGRGQNI Sbjct: 316 LKAVVFYGPNIGHIPHDIRLKDLNLLLWSGNGRGQNI 352 >dbj|BAD83538.2| ribosomal protein S4, partial (mitochondrion) [Nicotiana tabacum] Length = 349 Score = 77.0 bits (188), Expect = 3e-12 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +1 Query: 1 LKAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 LKAVVFYGPNIGHIPHDIRLKDLNL LWSG GRGQNI Sbjct: 313 LKAVVFYGPNIGHIPHDIRLKDLNLLLWSGKGRGQNI 349 >ref|YP_717175.1| ribosomal protein S4 [Brassica napus] gi|37591124|dbj|BAC98926.1| ribosomal protein S4 [Brassica napus] Length = 362 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +1 Query: 4 KAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 KAVVFYGPNIGHIPHDIRLKDLNL LWS NGRGQNI Sbjct: 327 KAVVFYGPNIGHIPHDIRLKDLNLLLWSRNGRGQNI 362 >sp|Q31708.2|RT04_ARATH RecName: Full=Ribosomal protein S4, mitochondrial Length = 362 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +1 Query: 4 KAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 KAVVFYGPNIGHIPHDIRLKDLNL LWS NGRGQNI Sbjct: 327 KAVVFYGPNIGHIPHDIRLKDLNLLLWSRNGRGQNI 362 >gb|ACH78250.1| ribosomal protein S4 [Arabidopsis thaliana] Length = 362 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +1 Query: 4 KAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 KAVVFYGPNIGHIPHDIRLKDLNL LWS NGRGQNI Sbjct: 327 KAVVFYGPNIGHIPHDIRLKDLNLLLWSRNGRGQNI 362 >ref|YP_003587235.1| ribosomal protein S4 [Citrullus lanatus] gi|259156791|gb|ACV96653.1| ribosomal protein S4 [Citrullus lanatus] Length = 355 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +1 Query: 1 LKAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 LKAVVFYGPNIGHIPHDIRLKDLNL L SGNGRGQNI Sbjct: 319 LKAVVFYGPNIGHIPHDIRLKDLNLPLRSGNGRGQNI 355 >ref|YP_004222288.1| ribosomal protein S4 [Beta vulgaris subsp. maritima] gi|317905723|emb|CBJ14108.1| ribosomal protein S4 [Beta vulgaris subsp. maritima] gi|319439803|emb|CBJ17515.1| ribosomal protein S4 [Beta vulgaris subsp. maritima] Length = 315 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +1 Query: 1 LKAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQN 108 LKAVVFYGPNI HIPHDIRLKDLNL LWSG GRGQN Sbjct: 279 LKAVVFYGPNIDHIPHDIRLKDLNLLLWSGKGRGQN 314 >ref|NP_064046.2| rps4 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|346683270|ref|YP_004842202.1| ribosomal protein S4 [Beta macrocarpa] gi|87248052|gb|ABD36080.1| ribosomal protein S4 [Beta vulgaris subsp. vulgaris] gi|148491424|dbj|BAA99356.2| ribosomal protein S4 [Beta vulgaris subsp. vulgaris] gi|320148708|emb|CBJ23346.1| ribosomal protein S4 [Beta vulgaris subsp. maritima] gi|345500188|emb|CBX25007.1| ribosomal protein S4 [Beta macrocarpa] gi|384939188|emb|CBL52035.1| ribosoma lprotein S4 (mitochondrion) [Beta vulgaris subsp. maritima] Length = 315 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +1 Query: 1 LKAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQN 108 LKAVVFYGPNI HIPHDIRLKDLNL LWSG GRGQN Sbjct: 279 LKAVVFYGPNIDHIPHDIRLKDLNLLLWSGKGRGQN 314 >emb|CBX33388.1| ribosomal protein S4 (mitochondrion) [Malus domestica] Length = 359 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +1 Query: 1 LKAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 LKAVV YGPNIGHIPHDIRLKDLNL L SGNGRGQNI Sbjct: 323 LKAVVSYGPNIGHIPHDIRLKDLNLXLRSGNGRGQNI 359 >ref|XP_004500180.1| PREDICTED: ribosomal protein S4, mitochondrial-like [Cicer arietinum] Length = 304 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +1 Query: 4 KAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 KAVVFYGPNIGHIPHDIRLKD NL L SGNGRGQNI Sbjct: 269 KAVVFYGPNIGHIPHDIRLKDPNLPLRSGNGRGQNI 304 >gb|AGC78977.1| ribosomal protein S4 (mitochondrion) [Vicia faba] Length = 346 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +1 Query: 4 KAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 KAVVFYGPNIGHIPHDIRLKD NL L SGNGRGQNI Sbjct: 311 KAVVFYGPNIGHIPHDIRLKDPNLPLRSGNGRGQNI 346 >ref|YP_007889804.1| ribosomal protein S4 (mitochondrion) [Vigna angularis] gi|478620963|dbj|BAN15009.1| ribosomal protein S4 (mitochondrion) [Vigna angularis] Length = 346 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +1 Query: 4 KAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 KAVVFYGPNIGHIPHDIRLKD NL L SGNGRGQNI Sbjct: 311 KAVVFYGPNIGHIPHDIRLKDPNLPLRSGNGRGQNI 346 >ref|YP_007516900.1| ribosomal protein S4 (mitochondrion) [Glycine max] gi|403311571|gb|AFR34319.1| ribosomal protein S4 (mitochondrion) [Glycine max] Length = 346 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +1 Query: 4 KAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 KAVVFYGPNIGHIPHDIRLKD NL L SGNGRGQNI Sbjct: 311 KAVVFYGPNIGHIPHDIRLKDPNLPLRSGNGRGQNI 346 >ref|XP_003588262.1| Ribosomal protein S4 [Medicago truncatula] gi|355477310|gb|AES58513.1| Ribosomal protein S4 [Medicago truncatula] Length = 349 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +1 Query: 4 KAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 KAVVFYGPNIGHIPHDIRLKD NL L SGNGRGQNI Sbjct: 314 KAVVFYGPNIGHIPHDIRLKDPNLPLRSGNGRGQNI 349 >ref|YP_004222821.1| ribosomal protein S4 [Vigna radiata] gi|308206763|gb|ADO19900.1| ribosomal protein S4 [Vigna radiata] Length = 346 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +1 Query: 4 KAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 KAVVFYGPNIGHIPHDIRLKD NL L SGNGRGQNI Sbjct: 311 KAVVFYGPNIGHIPHDIRLKDPNLPLRSGNGRGQNI 346 >gb|EXB66620.1| Ribosomal protein S4 [Morus notabilis] Length = 307 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +1 Query: 4 KAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 KAVV YGPNIGHIPHDIRLKDLNL L SGNGRGQNI Sbjct: 272 KAVVSYGPNIGHIPHDIRLKDLNLLLRSGNGRGQNI 307 >ref|YP_004237282.1| ribosomal protein S4 (mitochondrion) [Ricinus communis] gi|322394289|gb|ADW96046.1| ribosomal protein S4 (mitochondrion) [Ricinus communis] Length = 352 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +1 Query: 1 LKAVVFYGPNIGHIPHDIRLKDLNLHLWSGNGRGQNI 111 LKAVV YGP IGHIPHDIRLKDLNL L SGNGRGQNI Sbjct: 316 LKAVVSYGPKIGHIPHDIRLKDLNLPLRSGNGRGQNI 352