BLASTX nr result
ID: Cocculus23_contig00043978
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00043978 (263 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007212775.1| hypothetical protein PRUPE_ppa019758mg [Prun... 92 6e-17 ref|XP_004296481.1| PREDICTED: pentatricopeptide repeat-containi... 85 9e-15 ref|XP_006372189.1| cytochrome P450 71B10 family protein [Populu... 82 1e-13 gb|EXB30979.1| hypothetical protein L484_016839 [Morus notabilis] 79 9e-13 ref|XP_006474246.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 ref|XP_007014387.1| Pentatricopeptide repeat superfamily protein... 74 2e-11 ref|XP_004163031.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 ref|XP_004148334.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 gb|EYU38753.1| hypothetical protein MIMGU_mgv1a000602mg [Mimulus... 73 5e-11 ref|XP_007138785.1| hypothetical protein PHAVU_009G237200g [Phas... 72 1e-10 ref|XP_006453278.1| hypothetical protein CICLE_v10010743mg, part... 70 3e-10 ref|XP_002518234.1| pentatricopeptide repeat-containing protein,... 70 3e-10 ref|XP_006401224.1| hypothetical protein EUTSA_v10012580mg [Eutr... 67 3e-09 ref|XP_003547448.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-09 ref|XP_006357612.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_006279953.1| hypothetical protein CARUB_v10025820mg [Caps... 60 3e-07 ref|XP_004239478.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_002530223.1| pentatricopeptide repeat-containing protein,... 58 1e-06 ref|XP_004487970.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 dbj|BAA96948.1| salt-inducible protein-like [Arabidopsis thaliana] 57 3e-06 >ref|XP_007212775.1| hypothetical protein PRUPE_ppa019758mg [Prunus persica] gi|462408640|gb|EMJ13974.1| hypothetical protein PRUPE_ppa019758mg [Prunus persica] Length = 1104 Score = 92.4 bits (228), Expect = 6e-17 Identities = 46/85 (54%), Positives = 62/85 (72%), Gaps = 1/85 (1%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PTL++ QFL+FLS+ R V+H FSQM+SN+I GN++TRSI+ ALLK ++++EAE F Sbjct: 52 PTLKSIIQFLLFLSQTRRFNTVIHLFSQMDSNRIKGNSQTRSILTWALLKLHKYEEAEHF 111 Query: 83 M-TQMVKDGLSPQKGVWDSLIQGLC 12 M TQM + +WDSLIQGLC Sbjct: 112 MRTQMAETSKFQSNRIWDSLIQGLC 136 >ref|XP_004296481.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 1013 Score = 85.1 bits (209), Expect = 9e-15 Identities = 43/80 (53%), Positives = 59/80 (73%), Gaps = 1/80 (1%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PTL + QFL+FLS + R VL+FFSQM SN+I GN++TRSI+ RALLK ++++EAE F Sbjct: 42 PTLNSIIQFLLFLSHSRRFNTVLNFFSQMESNQIKGNSQTRSILTRALLKLHKYEEAEHF 101 Query: 83 M-TQMVKDGLSPQKGVWDSL 27 M TQM K P+ +WD++ Sbjct: 102 MRTQMAKASNFPRNRMWDTI 121 >ref|XP_006372189.1| cytochrome P450 71B10 family protein [Populus trichocarpa] gi|550318714|gb|ERP49986.1| cytochrome P450 71B10 family protein [Populus trichocarpa] Length = 1075 Score = 81.6 bits (200), Expect = 1e-13 Identities = 43/83 (51%), Positives = 57/83 (68%), Gaps = 1/83 (1%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PTL++ +QFL FLSK+H+ + HFF Q+N NKI N +T S+ ALLK ++F+EAE F Sbjct: 24 PTLKSINQFLHFLSKSHKYELITHFFCQINRNKIKCNPQTHSVFTCALLKLDKFEEAEHF 83 Query: 83 M-TQMVKDGLSPQKGVWDSLIQG 18 M TQM + GVWDSLI+G Sbjct: 84 MKTQMERSLKVSGFGVWDSLIRG 106 >gb|EXB30979.1| hypothetical protein L484_016839 [Morus notabilis] Length = 1240 Score = 78.6 bits (192), Expect = 9e-13 Identities = 41/86 (47%), Positives = 54/86 (62%), Gaps = 1/86 (1%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PTL+ +QFL FL +A + ++H FSQ NSN I GN+ T SI ALL ++ EAE+F Sbjct: 19 PTLKPLNQFLTFLFQARKFKLIIHLFSQANSNGITGNSETHSIFTWALLNLRKYKEAEQF 78 Query: 83 M-TQMVKDGLSPQKGVWDSLIQGLCT 9 M T MVK +WD+LI+G CT Sbjct: 79 MKTHMVKSSDFWNTRLWDTLIRGFCT 104 >ref|XP_006474246.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X1 [Citrus sinensis] gi|568840585|ref|XP_006474247.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X2 [Citrus sinensis] Length = 1074 Score = 77.4 bits (189), Expect = 2e-12 Identities = 41/83 (49%), Positives = 57/83 (68%), Gaps = 1/83 (1%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PTL + ++FL++LS+ R FV+HFFSQ+NSN I N++T S A ALLK ++F+EA F Sbjct: 31 PTLNSINKFLLWLSQNKRFNFVIHFFSQLNSNHIKPNSQTHSTFAWALLKLHKFEEAYHF 90 Query: 83 M-TQMVKDGLSPQKGVWDSLIQG 18 + TQ+ K Q +DSLIQG Sbjct: 91 LYTQVTKTSFPHQSRFFDSLIQG 113 >ref|XP_007014387.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508784750|gb|EOY32006.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 1087 Score = 74.3 bits (181), Expect = 2e-11 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 1/83 (1%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PTL++ ++ L+FLS R ++H FSQ+ SN I N++T SI+ AL K ++F+EAE Sbjct: 34 PTLKSVNRLLLFLSNTQRFNSIIHLFSQLESNNIKANSQTHSILTWALFKLHKFEEAEHL 93 Query: 83 M-TQMVKDGLSPQKGVWDSLIQG 18 M TQ+ P+ WDSLIQG Sbjct: 94 MTTQLSNSSNCPKTRFWDSLIQG 116 >ref|XP_004163031.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like [Cucumis sativus] Length = 1061 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/85 (40%), Positives = 59/85 (69%), Gaps = 1/85 (1%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PTL++ + F FL R +V+HFF Q+N+N+I GN++T I++ ALLKS+++D+ E+ Sbjct: 39 PTLKSINHFFRFLYHNRRFDYVIHFFYQLNANQIKGNSKTHLILSWALLKSHKYDDLEQI 98 Query: 83 M-TQMVKDGLSPQKGVWDSLIQGLC 12 + TQM+ + + +W+ LI+G+C Sbjct: 99 LKTQMLVSSIFHRNRLWNLLIRGIC 123 >ref|XP_004148334.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like [Cucumis sativus] Length = 1085 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/85 (40%), Positives = 59/85 (69%), Gaps = 1/85 (1%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PTL++ + F FL R +V+HFF Q+N+N+I GN++T I++ ALLKS+++D+ E+ Sbjct: 39 PTLKSINHFFRFLYHNRRFDYVIHFFYQLNANQIKGNSKTHLILSWALLKSHKYDDLEQI 98 Query: 83 M-TQMVKDGLSPQKGVWDSLIQGLC 12 + TQM+ + + +W+ LI+G+C Sbjct: 99 LKTQMLVSSIFHRNRLWNLLIRGIC 123 >gb|EYU38753.1| hypothetical protein MIMGU_mgv1a000602mg [Mimulus guttatus] Length = 1048 Score = 72.8 bits (177), Expect = 5e-11 Identities = 37/85 (43%), Positives = 58/85 (68%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PTL++F+ +FLS+ R ++H FSQ++SN+I +A+TR+I A+AL+K +R++EA F Sbjct: 14 PTLKDFNNLFLFLSRNQRFKAIIHVFSQLSSNQINADAQTRTIFAKALIKDSRYEEAADF 73 Query: 83 MTQMVKDGLSPQKGVWDSLIQGLCT 9 + + Q V+DSLIQ LCT Sbjct: 74 LR---THEIFHQNRVFDSLIQALCT 95 >ref|XP_007138785.1| hypothetical protein PHAVU_009G237200g [Phaseolus vulgaris] gi|561011872|gb|ESW10779.1| hypothetical protein PHAVU_009G237200g [Phaseolus vulgaris] Length = 1036 Score = 71.6 bits (174), Expect = 1e-10 Identities = 37/85 (43%), Positives = 55/85 (64%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PT + ++FL+FL + + HFFSQ+ +N N RT S++A ALLKS++F++AE+F Sbjct: 20 PTPKPINRFLLFLFHLQKFNLISHFFSQLQTNNAPTNPRTLSLLAWALLKSHKFEQAEQF 79 Query: 83 MTQMVKDGLSPQKGVWDSLIQGLCT 9 M +K +WD+LIQGLCT Sbjct: 80 MHTHLK---ITHPFMWDTLIQGLCT 101 >ref|XP_006453278.1| hypothetical protein CICLE_v10010743mg, partial [Citrus clementina] gi|557556504|gb|ESR66518.1| hypothetical protein CICLE_v10010743mg, partial [Citrus clementina] Length = 1036 Score = 70.1 bits (170), Expect = 3e-10 Identities = 38/75 (50%), Positives = 51/75 (68%), Gaps = 1/75 (1%) Frame = -1 Query: 239 FLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERFM-TQMVKD 63 FL++LS+ R FV+HFFSQ+NSN I N++T S A ALLK ++F+EA F+ TQ+ K Sbjct: 1 FLLWLSQNKRFNFVIHFFSQLNSNHIKPNSQTHSTFAWALLKLHKFEEAYHFLYTQVTKT 60 Query: 62 GLSPQKGVWDSLIQG 18 Q +DSLIQG Sbjct: 61 SFPHQSRFFDSLIQG 75 >ref|XP_002518234.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542581|gb|EEF44120.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 932 Score = 70.1 bits (170), Expect = 3e-10 Identities = 39/87 (44%), Positives = 52/87 (59%), Gaps = 2/87 (2%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PTL++ +Q+L+FL K H+ V HF SQ+N N+I GN +T S+ ALLK F+EAE F Sbjct: 36 PTLKSINQYLLFLVKIHKFTLVPHFLSQLNQNQIEGNYQTHSLFLLALLKLKNFEEAEHF 95 Query: 83 MTQMVKDGLSPQKG--VWDSLIQGLCT 9 + S KG DSLIQ + T Sbjct: 96 IKTHRAKSSSSSKGHKFLDSLIQAIST 122 >ref|XP_006401224.1| hypothetical protein EUTSA_v10012580mg [Eutrema salsugineum] gi|557102314|gb|ESQ42677.1| hypothetical protein EUTSA_v10012580mg [Eutrema salsugineum] Length = 971 Score = 66.6 bits (161), Expect = 3e-09 Identities = 35/83 (42%), Positives = 54/83 (65%), Gaps = 1/83 (1%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PTL + +FL +L + + +LHF+SQ++S K+ N R SIV+ A L NR++EAE+F Sbjct: 24 PTLNSIDRFLRYLYRRQKFNCILHFYSQLDSEKLQVNNRIYSIVSWAFLNLNRYEEAEKF 83 Query: 83 M-TQMVKDGLSPQKGVWDSLIQG 18 + TQ+ K + P+ + DSLI G Sbjct: 84 INTQISKASIFPRTHMLDSLIHG 106 >ref|XP_003547448.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X1 [Glycine max] gi|571519120|ref|XP_006597790.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X2 [Glycine max] gi|571519126|ref|XP_006597791.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X3 [Glycine max] gi|571519129|ref|XP_006597792.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X4 [Glycine max] gi|571519133|ref|XP_006597793.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X5 [Glycine max] Length = 1064 Score = 65.9 bits (159), Expect = 6e-09 Identities = 35/83 (42%), Positives = 50/83 (60%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PT + + FL+FL + + + HFFSQ+ SN N RT S++ +LLKS++F+EAE+F Sbjct: 20 PTPKPINCFLLFLFRHRKFNLITHFFSQLKSNNAPTNRRTLSLLTWSLLKSHKFEEAEQF 79 Query: 83 MTQMVKDGLSPQKGVWDSLIQGL 15 M +WDSLIQGL Sbjct: 80 MHSHTH---ITHSSMWDSLIQGL 99 >ref|XP_006357612.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like [Solanum tuberosum] Length = 1057 Score = 60.5 bits (145), Expect = 2e-07 Identities = 35/88 (39%), Positives = 56/88 (63%), Gaps = 4/88 (4%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PT +F+QFL+FLSK+ R ++ + SN+ G+++TR I +AL+K +++DEA ++ Sbjct: 36 PTTTHFNQFLLFLSKSKRFKLIIDL---VKSNQFKGDSKTRRIFIQALVKEDKYDEAVQY 92 Query: 83 M----TQMVKDGLSPQKGVWDSLIQGLC 12 + TQM QK ++DSLIQ LC Sbjct: 93 LKGKNTQM-------QKSLFDSLIQPLC 113 >ref|XP_006279953.1| hypothetical protein CARUB_v10025820mg [Capsella rubella] gi|482548657|gb|EOA12851.1| hypothetical protein CARUB_v10025820mg [Capsella rubella] Length = 971 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/83 (37%), Positives = 53/83 (63%), Gaps = 1/83 (1%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PTL + +FL +L + + ++H +SQ++S ++ N R SIV+ A L NR+++AE+F Sbjct: 24 PTLNSIDRFLRYLYRRQKFNCIVHLYSQLDSRQVHINHRIYSIVSWAFLNLNRYEDAEKF 83 Query: 83 M-TQMVKDGLSPQKGVWDSLIQG 18 + TQ+ K + P+ + DSLI G Sbjct: 84 INTQISKASIFPRTHMLDSLIHG 106 >ref|XP_004239478.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like [Solanum lycopersicum] Length = 1047 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/84 (38%), Positives = 51/84 (60%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PT F+QFL FLSK+ R ++H + SN+ G+++TR I AL+K +++DEA + Sbjct: 26 PTATQFNQFLFFLSKSKRFKLIIHL---VKSNQFKGDSKTRRIFIEALVKEDKYDEAVQC 82 Query: 83 MTQMVKDGLSPQKGVWDSLIQGLC 12 + + +K ++DSLIQ LC Sbjct: 83 LKE---KNTQMEKRLFDSLIQPLC 103 >ref|XP_002530223.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530270|gb|EEF32170.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 517 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/87 (33%), Positives = 48/87 (55%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PT+E+ + +L L HR+ L F+ +M +I N TR++V RA KS + ++A + Sbjct: 179 PTVESCNAYLSSLLDLHRVDIALAFYKEMRRCRISPNVYTRNMVMRAFCKSGKLEKAVQV 238 Query: 83 MTQMVKDGLSPQKGVWDSLIQGLCTAG 3 +M G+SP +++LI G C G Sbjct: 239 FEEMESVGISPNDTSYNTLIMGYCRKG 265 >ref|XP_004487970.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X1 [Cicer arietinum] gi|502085668|ref|XP_004487971.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X2 [Cicer arietinum] gi|502085671|ref|XP_004487972.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X3 [Cicer arietinum] gi|502085674|ref|XP_004487973.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X4 [Cicer arietinum] gi|502085678|ref|XP_004487974.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X5 [Cicer arietinum] gi|502085682|ref|XP_004487975.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X6 [Cicer arietinum] Length = 1070 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/84 (35%), Positives = 47/84 (55%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PT + + F+ FL + +++ F Q +NKI N T + ALLKS+ F++AE+ Sbjct: 20 PTPNSINTFIFFLFNLRKFNLIINLFHQFTTNKIPTNHNTHNFFTWALLKSHNFEQAEKI 79 Query: 83 MTQMVKDGLSPQKGVWDSLIQGLC 12 M + K +P + WDSLI+G C Sbjct: 80 MKKNYK---TPSR-AWDSLIRGFC 99 >dbj|BAA96948.1| salt-inducible protein-like [Arabidopsis thaliana] Length = 1012 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 1/83 (1%) Frame = -1 Query: 263 PTLENFHQFLVFLSKAHRIGFVLHFFSQMNSNKILGNARTRSIVARALLKSNRFDEAERF 84 PTL + +FL +L + + +L F+SQ++S +I N R SIV+ A L NR+++AE+F Sbjct: 65 PTLNSIDRFLRYLYRLQKFNCILQFYSQLDSKQININHRIYSIVSWAFLNLNRYEDAEKF 124 Query: 83 MT-QMVKDGLSPQKGVWDSLIQG 18 + + K + P+ + DSLI G Sbjct: 125 INIHISKASIFPRTHMLDSLIHG 147