BLASTX nr result
ID: Cocculus23_contig00042288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00042288 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275344.2| PREDICTED: pentatricopeptide repeat-containi... 108 1e-21 emb|CBI25349.3| unnamed protein product [Vitis vinifera] 108 1e-21 ref|XP_006358742.1| PREDICTED: pentatricopeptide repeat-containi... 107 1e-21 ref|XP_004241092.1| PREDICTED: pentatricopeptide repeat-containi... 107 1e-21 ref|XP_007011261.1| Pentatricopeptide repeat-containing protein,... 107 2e-21 ref|XP_002520874.1| pentatricopeptide repeat-containing protein,... 107 2e-21 ref|XP_002319343.2| hypothetical protein POPTR_0013s09430g, part... 107 2e-21 gb|EYU35195.1| hypothetical protein MIMGU_mgv1a024029mg, partial... 94 2e-17 ref|XP_002879887.1| hypothetical protein ARALYDRAFT_903365 [Arab... 88 1e-15 ref|NP_181604.1| pentatricopeptide repeat-containing protein [Ar... 87 2e-15 gb|EXB37797.1| hypothetical protein L484_002732 [Morus notabilis] 82 6e-14 gb|EYU26534.1| hypothetical protein MIMGU_mgv1a024701mg, partial... 80 2e-13 ref|XP_006295646.1| hypothetical protein CARUB_v10024761mg [Caps... 80 2e-13 ref|XP_006411338.1| hypothetical protein EUTSA_v10017587mg [Eutr... 80 4e-13 ref|XP_007159576.1| hypothetical protein PHAVU_002G249000g [Phas... 78 1e-12 ref|XP_007042234.1| Mitochondrial editing factor 21 [Theobroma c... 78 1e-12 ref|XP_004308755.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 ref|XP_004295518.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 ref|XP_007204422.1| hypothetical protein PRUPE_ppb002215mg [Prun... 77 3e-12 ref|XP_002269662.2| PREDICTED: putative pentatricopeptide repeat... 76 4e-12 >ref|XP_002275344.2| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Vitis vinifera] Length = 836 Score = 108 bits (269), Expect = 1e-21 Identities = 51/81 (62%), Positives = 65/81 (80%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P +GSNYV LLNLY E +W++AANLR SMK +GLKK+PGCSWIE+K+ ++FFSGDSSS Sbjct: 747 PARGSNYVPLLNLYGEVEMWDRAANLRASMKGRGLKKSPGCSWIEVKNRVDVFFSGDSSS 806 Query: 183 YLTLEIYETLNSLRDIMELDG 245 +EIY+TL+SL+ ME G Sbjct: 807 TRRIEIYKTLSSLKSNMEGKG 827 >emb|CBI25349.3| unnamed protein product [Vitis vinifera] Length = 1241 Score = 108 bits (269), Expect = 1e-21 Identities = 51/81 (62%), Positives = 65/81 (80%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P +GSNYV LLNLY E +W++AANLR SMK +GLKK+PGCSWIE+K+ ++FFSGDSSS Sbjct: 1152 PARGSNYVPLLNLYGEVEMWDRAANLRASMKGRGLKKSPGCSWIEVKNRVDVFFSGDSSS 1211 Query: 183 YLTLEIYETLNSLRDIMELDG 245 +EIY+TL+SL+ ME G Sbjct: 1212 TRRIEIYKTLSSLKSNMEGKG 1232 >ref|XP_006358742.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720-like [Solanum tuberosum] Length = 850 Score = 107 bits (268), Expect = 1e-21 Identities = 53/82 (64%), Positives = 65/82 (79%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P +GSNYVQLLNLY E G+ E+AA+LR M+ KGLKKNPGCSWIE+K+ +F+S DSSS Sbjct: 763 PNRGSNYVQLLNLYVEGGMREEAASLRTLMRQKGLKKNPGCSWIEVKNELEVFYSCDSSS 822 Query: 183 YLTLEIYETLNSLRDIMELDGN 248 T+EIYETL SLR IM+ G+ Sbjct: 823 TKTIEIYETLQSLRSIMKKRGD 844 >ref|XP_004241092.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720-like [Solanum lycopersicum] Length = 850 Score = 107 bits (268), Expect = 1e-21 Identities = 52/82 (63%), Positives = 64/82 (78%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P +GSNYVQLLNLY E G+ E+AA+LR M+ KGLKKNPGCSWIE+K+ +F+S DSSS Sbjct: 763 PNRGSNYVQLLNLYVEGGMREEAASLRALMRQKGLKKNPGCSWIEVKNELEVFYSSDSSS 822 Query: 183 YLTLEIYETLNSLRDIMELDGN 248 T+EIYETL LR IM+ G+ Sbjct: 823 TKTIEIYETLQGLRSIMKKKGD 844 >ref|XP_007011261.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508728174|gb|EOY20071.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 849 Score = 107 bits (267), Expect = 2e-21 Identities = 51/78 (65%), Positives = 65/78 (83%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P++GSNYVQLL+LY E GL +KAAN+R +MK +GLKKNPGCSWIE+++ ++FFSGDSSS Sbjct: 760 PSRGSNYVQLLHLYGEAGLQDKAANIRATMKERGLKKNPGCSWIELRNKVDVFFSGDSSS 819 Query: 183 YLTLEIYETLNSLRDIME 236 T+EIYE L+SL ME Sbjct: 820 LRTMEIYEILHSLGRNME 837 >ref|XP_002520874.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540005|gb|EEF41583.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 833 Score = 107 bits (267), Expect = 2e-21 Identities = 49/74 (66%), Positives = 62/74 (83%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P+KGSNYVQLLNLY E LW++ ANLR SMK KGLKK PGCSWIE+++ ++F+SGD SS Sbjct: 744 PSKGSNYVQLLNLYGEAELWDRTANLRASMKEKGLKKTPGCSWIEVRNKVDVFYSGDCSS 803 Query: 183 YLTLEIYETLNSLR 224 +T EIY+TL+SL+ Sbjct: 804 PITTEIYDTLSSLK 817 >ref|XP_002319343.2| hypothetical protein POPTR_0013s09430g, partial [Populus trichocarpa] gi|550325356|gb|EEE95266.2| hypothetical protein POPTR_0013s09430g, partial [Populus trichocarpa] Length = 792 Score = 107 bits (266), Expect = 2e-21 Identities = 53/81 (65%), Positives = 63/81 (77%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P++GSNYVQLLNLY E L ++AANLR SMK KGLKK PGCSWIE+ + ++FFSGDSSS Sbjct: 704 PSRGSNYVQLLNLYGENELQDRAANLRASMKEKGLKKTPGCSWIEVGNSIDVFFSGDSSS 763 Query: 183 YLTLEIYETLNSLRDIMELDG 245 T+EIY+ LNSLR M G Sbjct: 764 PRTIEIYDLLNSLRRNMRKKG 784 >gb|EYU35195.1| hypothetical protein MIMGU_mgv1a024029mg, partial [Mimulus guttatus] Length = 820 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/77 (59%), Positives = 59/77 (76%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P GS Y+QLLNLY E G+ EKAA LR M+ KGL K PGCSWIE+K+ ++F+SGDSSS Sbjct: 735 PESGSGYIQLLNLYVEMGMKEKAAKLRGVMREKGLTKVPGCSWIEVKNKVDVFYSGDSSS 794 Query: 183 YLTLEIYETLNSLRDIM 233 T++IYETL+ L++ M Sbjct: 795 LSTVKIYETLDILKNSM 811 >ref|XP_002879887.1| hypothetical protein ARALYDRAFT_903365 [Arabidopsis lyrata subsp. lyrata] gi|297325726|gb|EFH56146.1| hypothetical protein ARALYDRAFT_903365 [Arabidopsis lyrata subsp. lyrata] Length = 1359 Score = 87.8 bits (216), Expect = 1e-15 Identities = 43/77 (55%), Positives = 54/77 (70%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P +GS YVQL+NLY E GL +AA L MK +GL+K PGCSWIE+ D N+FFSG SSS Sbjct: 1276 PERGSTYVQLINLYMEAGLKNEAAKLLGEMKERGLQKQPGCSWIEVSDISNVFFSGGSSS 1335 Query: 183 YLTLEIYETLNSLRDIM 233 + EI++ LN L+ M Sbjct: 1336 PIKAEIFKVLNRLKSNM 1352 >ref|NP_181604.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75276036|sp|Q7XJN6.1|PP197_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g40720 gi|330254774|gb|AEC09868.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 860 Score = 87.4 bits (215), Expect = 2e-15 Identities = 44/77 (57%), Positives = 52/77 (67%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P +GS YVQL+NLY E GL +AA L MK KGL K PGCSWIE+ D N+FFSG SSS Sbjct: 777 PERGSTYVQLINLYMEAGLKNEAAKLLGLMKEKGLHKQPGCSWIEVSDRTNVFFSGGSSS 836 Query: 183 YLTLEIYETLNSLRDIM 233 + EI+ LN L+ M Sbjct: 837 PMKAEIFNVLNRLKSNM 853 >gb|EXB37797.1| hypothetical protein L484_002732 [Morus notabilis] Length = 672 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/81 (48%), Positives = 53/81 (65%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P +NYV L N+YAE G+W++ ANLR +K +G++K PGCSWIE+ +MF GD+S Sbjct: 500 PYSSANYVHLSNMYAEAGMWKEVANLRDLLKYRGIRKTPGCSWIEVNGKAHMFLGGDTSH 559 Query: 183 YLTLEIYETLNSLRDIMELDG 245 T EIY L SL + M+ G Sbjct: 560 PQTREIYMFLESLPEKMKQAG 580 >gb|EYU26534.1| hypothetical protein MIMGU_mgv1a024701mg, partial [Mimulus guttatus] Length = 518 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/81 (48%), Positives = 51/81 (62%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P NYV L N+YAE G+WE+ +LR +K+K +KKNPGCSWIEM ++F GD+S Sbjct: 346 PENSGNYVILSNMYAEAGMWEEVDSLRGVLKSKCVKKNPGCSWIEMNGKAHLFLGGDASH 405 Query: 183 YLTLEIYETLNSLRDIMELDG 245 T EIY L L + M+ G Sbjct: 406 AQTREIYSFLEELPEKMKAAG 426 >ref|XP_006295646.1| hypothetical protein CARUB_v10024761mg [Capsella rubella] gi|482564354|gb|EOA28544.1| hypothetical protein CARUB_v10024761mg [Capsella rubella] Length = 858 Score = 80.5 bits (197), Expect = 2e-13 Identities = 41/77 (53%), Positives = 51/77 (66%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P + S YVQL+NLY E GL +AA L MK KGL+K PGCSWIE+ + FFSG SSS Sbjct: 775 PERSSAYVQLINLYKEAGLKNEAAKLLGEMKDKGLQKKPGCSWIEVSNRKYAFFSGGSSS 834 Query: 183 YLTLEIYETLNSLRDIM 233 + EI+ LN L++ M Sbjct: 835 SVKAEIFNVLNRLKNNM 851 >ref|XP_006411338.1| hypothetical protein EUTSA_v10017587mg [Eutrema salsugineum] gi|557112507|gb|ESQ52791.1| hypothetical protein EUTSA_v10017587mg [Eutrema salsugineum] Length = 858 Score = 79.7 bits (195), Expect = 4e-13 Identities = 41/77 (53%), Positives = 52/77 (67%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P +GSNYVQL+NLY E GL +AA L MK +GL+K PG S IE+ ++FFSG SSS Sbjct: 775 PERGSNYVQLINLYMEAGLKNEAAKLLSEMKERGLQKKPGWSRIEISSMTHVFFSGGSSS 834 Query: 183 YLTLEIYETLNSLRDIM 233 + EI+ LNSL+ M Sbjct: 835 LMAAEIFNVLNSLKSNM 851 >ref|XP_007159576.1| hypothetical protein PHAVU_002G249000g [Phaseolus vulgaris] gi|561032991|gb|ESW31570.1| hypothetical protein PHAVU_002G249000g [Phaseolus vulgaris] Length = 810 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/79 (46%), Positives = 49/79 (62%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P NYV L NLYA G W A R SMK G+KK+PGCSWIE +DG ++F + D + Sbjct: 726 PNNPGNYVMLANLYASVGKWHYLAQTRQSMKDMGMKKSPGCSWIEDRDGIHVFVASDKTH 785 Query: 183 YLTLEIYETLNSLRDIMEL 239 T +IY LNSL +++ + Sbjct: 786 KRTDDIYSILNSLTNLIRM 804 >ref|XP_007042234.1| Mitochondrial editing factor 21 [Theobroma cacao] gi|508706169|gb|EOX98065.1| Mitochondrial editing factor 21 [Theobroma cacao] Length = 613 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/81 (44%), Positives = 49/81 (60%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P NYV L NLYAE G+W++A LR +K +G+KKNPGCSW E+ + F GD+S Sbjct: 501 PENSGNYVMLSNLYAEAGMWKEADKLRAHLKCQGIKKNPGCSWTEINGKAHFFLGGDTSH 560 Query: 183 YLTLEIYETLNSLRDIMELDG 245 EIY L +L + ++ G Sbjct: 561 PQAKEIYNLLEALLEKIKAAG 581 >ref|XP_004308755.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Fragaria vesca subsp. vesca] Length = 631 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/81 (43%), Positives = 50/81 (61%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P NYV L N+YAE G+W++ LRI +K++G+KK+PGCSWIE+ ++F GD+S Sbjct: 397 PDNSGNYVLLSNIYAEAGMWKEVDKLRILLKSQGMKKSPGCSWIEVNGKAHLFLGGDTSH 456 Query: 183 YLTLEIYETLNSLRDIMELDG 245 E+Y L L M+ G Sbjct: 457 PQAKEVYMLLEELPKKMKAAG 477 >ref|XP_004295518.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 893 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/81 (43%), Positives = 53/81 (65%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P S+YV L N+Y+ GLWEKA ++R MK G++K PGCSWIE +D + F +GD S Sbjct: 721 PDVASHYVLLSNIYSSSGLWEKAMDIRRKMKEMGVRKEPGCSWIEFEDEVHKFLAGDMSH 780 Query: 183 YLTLEIYETLNSLRDIMELDG 245 + +++E L +L + M+ +G Sbjct: 781 PQSEQLHEYLETLSERMKKEG 801 >ref|XP_007204422.1| hypothetical protein PRUPE_ppb002215mg [Prunus persica] gi|462399953|gb|EMJ05621.1| hypothetical protein PRUPE_ppb002215mg [Prunus persica] Length = 634 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/81 (44%), Positives = 50/81 (61%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P K Y+ L N+YA G W +AA +R+ MK KGLKK PGCSWIE+ + ++F GD S Sbjct: 540 PEKAGTYLLLCNIYASSGKWREAAKIRMKMKEKGLKKQPGCSWIEVGNKVHVFVVGDKSH 599 Query: 183 YLTLEIYETLNSLRDIMELDG 245 Y + IY + +L + M+ G Sbjct: 600 YQSELIYSLIYNLHERMKKIG 620 >ref|XP_002269662.2| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142-like [Vitis vinifera] Length = 689 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/81 (43%), Positives = 50/81 (61%) Frame = +3 Query: 3 PTKGSNYVQLLNLYAEEGLWEKAANLRISMKAKGLKKNPGCSWIEMKDGHNMFFSGDSSS 182 P NYV L NLYAE G+WE+ LR +K +G+KK+PGCSWIE+ ++F D S Sbjct: 517 PDNSGNYVLLSNLYAEAGMWEEVKKLRALLKYQGMKKSPGCSWIEINGKSHLFMGADKSH 576 Query: 183 YLTLEIYETLNSLRDIMELDG 245 EIY+ L +L + +++ G Sbjct: 577 PQAKEIYKFLEALPEKIKMAG 597