BLASTX nr result
ID: Cocculus23_contig00042023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00042023 (260 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845044.1| hypothetical protein AMTR_s00269p00010030 [A... 91 2e-16 >ref|XP_006845044.1| hypothetical protein AMTR_s00269p00010030 [Amborella trichopoda] gi|548847541|gb|ERN06719.1| hypothetical protein AMTR_s00269p00010030 [Amborella trichopoda] Length = 223 Score = 90.5 bits (223), Expect = 2e-16 Identities = 44/79 (55%), Positives = 53/79 (67%), Gaps = 1/79 (1%) Frame = +1 Query: 25 MEPQAKRYRSENSWFESNSRVLEQLGGGGVD-QCRRFNTPEGCSFGSACRFRHVSADGRD 201 MEP KR RSE+ +N RV E D +CRR+NTPEGC FGS CRFRH ++D RD Sbjct: 1 MEPMIKRPRSEDVGSGTNPRVSETHEWSNGDMECRRYNTPEGCPFGSNCRFRHGASDNRD 60 Query: 202 MGSQGLSSGGRPKPCMKFF 258 + Q +S G +PKPCMKFF Sbjct: 61 ISQQNMSLGAKPKPCMKFF 79