BLASTX nr result
ID: Cocculus23_contig00042003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00042003 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC27870.1| hypothetical protein L484_009192 [Morus notabilis] 59 7e-07 >gb|EXC27870.1| hypothetical protein L484_009192 [Morus notabilis] Length = 94 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/68 (41%), Positives = 36/68 (52%) Frame = -1 Query: 329 RQILWSVGGQAICWSIWVERNHRTFEDREACWEDVWDLMKSRVASWLTVEKNFWVWSQAM 150 R +LW V AI W IW+ERN R FE RE WD +K +A W+ K F + Sbjct: 27 RSVLWKVAMMAIWWRIWLERNRRIFERREEDSIITWDRIKLNIALWIHSNKEFCDLLYSD 86 Query: 149 LLNDWRNF 126 L+ DW +F Sbjct: 87 LVRDWPSF 94