BLASTX nr result
ID: Cocculus23_contig00041846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00041846 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004289579.1| PREDICTED: putative pentatricopeptide repeat... 58 2e-06 >ref|XP_004289579.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490-like [Fragaria vesca subsp. vesca] Length = 883 Score = 57.8 bits (138), Expect = 2e-06 Identities = 44/111 (39%), Positives = 56/111 (50%), Gaps = 22/111 (19%) Frame = +2 Query: 5 IYAHKLFQLSHEKD----------------GEEVLRAFSGMLDLGD*A*YCIPTICVQTY 136 +YA+KLFQ S KD GEE LR FS ML+LG I T + Sbjct: 655 LYAYKLFQSSLHKDLVMFTAMIGGFAMHGMGEEALRIFSHMLELGIKPDNVIITAVLSA- 713 Query: 137 WPCQ*MG------KAF*SSDIGSWGIKPTMESYACLVDLLAQGGHLRDAYS 271 C G K F + + +G+KPTME YAC+VDLL +GG + DA+S Sbjct: 714 --CSHAGLVNEGLKIFHTIE-EVYGVKPTMEQYACVVDLLGRGGRIDDAFS 761