BLASTX nr result
ID: Cocculus23_contig00041283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00041283 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME84108.1| hypothetical protein MYCFIDRAFT_214620 [Pseudocer... 110 2e-22 gb|EMC97988.1| hypothetical protein BAUCODRAFT_31996 [Baudoinia ... 110 3e-22 ref|XP_003853833.1| hypothetical protein MYCGRDRAFT_103718 [Zymo... 110 3e-22 gb|EME44952.1| hypothetical protein DOTSEDRAFT_70860 [Dothistrom... 109 3e-22 gb|EMF13527.1| HAD-superfamily hydrolase [Sphaerulina musiva SO2... 104 1e-20 ref|XP_003302916.1| hypothetical protein PTT_14913 [Pyrenophora ... 103 3e-20 gb|EUC40040.1| hypothetical protein COCMIDRAFT_41568 [Bipolaris ... 102 7e-20 gb|EUC33806.1| hypothetical protein COCCADRAFT_36461 [Bipolaris ... 102 7e-20 gb|EMD95572.1| hypothetical protein COCHEDRAFT_1019286 [Bipolari... 102 7e-20 ref|XP_001939350.1| HAD-superfamily hydrolase [Pyrenophora triti... 102 7e-20 ref|XP_003837339.1| similar to HAD-superfamily hydrolase [Leptos... 100 2e-19 ref|XP_001799083.1| hypothetical protein SNOG_08775 [Phaeosphaer... 100 2e-19 gb|EMD69690.1| hypothetical protein COCSADRAFT_32370 [Bipolaris ... 100 4e-19 gb|EHY57177.1| phosphoglycolate phosphatase [Exophiala dermatiti... 99 8e-19 gb|EXJ61690.1| hypothetical protein A1O7_02119 [Cladophialophora... 97 3e-18 gb|ETN41955.1| hypothetical protein HMPREF1541_03894 [Cyphelloph... 96 4e-18 gb|ETI27255.1| hypothetical protein G647_09938 [Cladophialophora... 96 5e-18 gb|ETS73909.1| hypothetical protein PFICI_13775 [Pestalotiopsis ... 96 7e-18 gb|EMR71287.1| putative haloacid dehalogenase-like hydrolase pro... 94 1e-17 gb|EXJ66690.1| phosphoglycolate phosphatase [Cladophialophora ps... 93 3e-17 >gb|EME84108.1| hypothetical protein MYCFIDRAFT_214620 [Pseudocercospora fijiensis CIRAD86] Length = 249 Score = 110 bits (276), Expect = 2e-22 Identities = 51/58 (87%), Positives = 56/58 (96%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M KVKYILLDCDNTLC+SERLAFEACADLTNEV+EK+ I+ARY+TDSLLEDFVGHNFR Sbjct: 1 MGKVKYILLDCDNTLCQSERLAFEACADLTNEVLEKYGIEARYDTDSLLEDFVGHNFR 58 >gb|EMC97988.1| hypothetical protein BAUCODRAFT_31996 [Baudoinia compniacensis UAMH 10762] Length = 248 Score = 110 bits (274), Expect = 3e-22 Identities = 50/58 (86%), Positives = 54/58 (93%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M K KYILLDCDNTLC+SERLAFEAC++LTNEV+EKH IDARYN DSLLEDFVGHNFR Sbjct: 1 MGKCKYILLDCDNTLCQSERLAFEACSELTNEVLEKHKIDARYNVDSLLEDFVGHNFR 58 >ref|XP_003853833.1| hypothetical protein MYCGRDRAFT_103718 [Zymoseptoria tritici IPO323] gi|339473716|gb|EGP88809.1| hypothetical protein MYCGRDRAFT_103718 [Zymoseptoria tritici IPO323] Length = 248 Score = 110 bits (274), Expect = 3e-22 Identities = 50/58 (86%), Positives = 57/58 (98%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 MAKVKYILLDCDNTLC+SERLAFEACADLTNE+MEK+ +DARY+TD+LLEDFVG+NFR Sbjct: 1 MAKVKYILLDCDNTLCQSERLAFEACADLTNEIMEKYGLDARYDTDALLEDFVGNNFR 58 >gb|EME44952.1| hypothetical protein DOTSEDRAFT_70860 [Dothistroma septosporum NZE10] Length = 248 Score = 109 bits (273), Expect = 3e-22 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M KVKYILLDCDNTLC SERLAFEACADLTNEVMEK++IDARY TDSLLEDFVG+NFR Sbjct: 1 MGKVKYILLDCDNTLCLSERLAFEACADLTNEVMEKYSIDARYTTDSLLEDFVGNNFR 58 >gb|EMF13527.1| HAD-superfamily hydrolase [Sphaerulina musiva SO2202] Length = 249 Score = 104 bits (259), Expect = 1e-20 Identities = 48/58 (82%), Positives = 55/58 (94%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M KVKYILLDCDNTLC+SERLAFEACADLTNEV++K++IDA Y T+SLLEDFVG+NFR Sbjct: 1 MGKVKYILLDCDNTLCQSERLAFEACADLTNEVLKKYDIDATYTTESLLEDFVGNNFR 58 >ref|XP_003302916.1| hypothetical protein PTT_14913 [Pyrenophora teres f. teres 0-1] gi|311321422|gb|EFQ88990.1| hypothetical protein PTT_14913 [Pyrenophora teres f. teres 0-1] Length = 248 Score = 103 bits (256), Expect = 3e-20 Identities = 47/58 (81%), Positives = 51/58 (87%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M K KYI+LDCDNTL +SER AFEACADLTN+VMEKH I+ARY DSLLEDFVGHNFR Sbjct: 1 MGKAKYIMLDCDNTLVQSERFAFEACADLTNQVMEKHKIEARYTADSLLEDFVGHNFR 58 >gb|EUC40040.1| hypothetical protein COCMIDRAFT_41568 [Bipolaris oryzae ATCC 44560] Length = 248 Score = 102 bits (253), Expect = 7e-20 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M K KYI+LDCDNTL +SER AFEACADLTNEV+ KHNIDARY ++LLEDFVGHNFR Sbjct: 1 MGKAKYIMLDCDNTLVQSERYAFEACADLTNEVLSKHNIDARYTAETLLEDFVGHNFR 58 >gb|EUC33806.1| hypothetical protein COCCADRAFT_36461 [Bipolaris zeicola 26-R-13] gi|578495574|gb|EUN32955.1| hypothetical protein COCVIDRAFT_21457 [Bipolaris victoriae FI3] Length = 248 Score = 102 bits (253), Expect = 7e-20 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M K KYI+LDCDNTL +SER AFEACADLTNEV+ KHNIDARY ++LLEDFVGHNFR Sbjct: 1 MGKAKYIMLDCDNTLVQSERYAFEACADLTNEVLSKHNIDARYTAETLLEDFVGHNFR 58 >gb|EMD95572.1| hypothetical protein COCHEDRAFT_1019286 [Bipolaris maydis C5] gi|477593365|gb|ENI10434.1| hypothetical protein COCC4DRAFT_46198 [Bipolaris maydis ATCC 48331] Length = 248 Score = 102 bits (253), Expect = 7e-20 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M K KYI+LDCDNTL +SER AFEACADLTNEV+ KHNIDARY ++LLEDFVGHNFR Sbjct: 1 MGKAKYIMLDCDNTLVQSERYAFEACADLTNEVLSKHNIDARYTAETLLEDFVGHNFR 58 >ref|XP_001939350.1| HAD-superfamily hydrolase [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187975443|gb|EDU42069.1| HAD-superfamily hydrolase [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 248 Score = 102 bits (253), Expect = 7e-20 Identities = 47/58 (81%), Positives = 51/58 (87%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M K KYI+LDCDNTL +SER AFEACADLTN+VMEKHNI+ARY DSLLE FVGHNFR Sbjct: 1 MGKAKYIMLDCDNTLVQSERFAFEACADLTNQVMEKHNIEARYTADSLLEVFVGHNFR 58 >ref|XP_003837339.1| similar to HAD-superfamily hydrolase [Leptosphaeria maculans JN3] gi|312213897|emb|CBX93899.1| similar to HAD-superfamily hydrolase [Leptosphaeria maculans JN3] Length = 248 Score = 100 bits (250), Expect = 2e-19 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M K KYI+LDCDNTL +SER+AF ACA+LTNEVM+KHNIDA Y DSLLEDFVGHNFR Sbjct: 1 MGKAKYIMLDCDNTLVQSERVAFAACAELTNEVMKKHNIDATYTADSLLEDFVGHNFR 58 >ref|XP_001799083.1| hypothetical protein SNOG_08775 [Phaeosphaeria nodorum SN15] gi|111062823|gb|EAT83943.1| hypothetical protein SNOG_08775 [Phaeosphaeria nodorum SN15] Length = 249 Score = 100 bits (249), Expect = 2e-19 Identities = 47/58 (81%), Positives = 49/58 (84%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M K KYI+LDCDNTL +SER AFEACADLTN VMEKHNI RY DSLLEDFVGHNFR Sbjct: 1 MGKAKYIMLDCDNTLVQSERFAFEACADLTNIVMEKHNIKERYTADSLLEDFVGHNFR 58 >gb|EMD69690.1| hypothetical protein COCSADRAFT_32370 [Bipolaris sorokiniana ND90Pr] Length = 248 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M K KYI+LDCDNTL +SER AFEACADLTNEV+ KHNIDA Y ++LLEDFVGHNFR Sbjct: 1 MGKAKYIMLDCDNTLVQSERYAFEACADLTNEVLSKHNIDATYTAETLLEDFVGHNFR 58 >gb|EHY57177.1| phosphoglycolate phosphatase [Exophiala dermatitidis NIH/UT8656] Length = 248 Score = 98.6 bits (244), Expect = 8e-19 Identities = 46/58 (79%), Positives = 49/58 (84%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M KVKY+LLDCDNTL SERLAFEACADLTNEV+EKH + RY DSLLEDFVG NFR Sbjct: 1 MPKVKYVLLDCDNTLVLSERLAFEACADLTNEVLEKHGVPERYTVDSLLEDFVGQNFR 58 >gb|EXJ61690.1| hypothetical protein A1O7_02119 [Cladophialophora yegresii CBS 114405] Length = 248 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M KVKYILLDCDNTLC SERLAFEAC DLTNE++EK+NI RY D LLE FVG NFR Sbjct: 1 MGKVKYILLDCDNTLCLSERLAFEACTDLTNELLEKYNISERYTVDDLLEAFVGQNFR 58 >gb|ETN41955.1| hypothetical protein HMPREF1541_03894 [Cyphellophora europaea CBS 101466] Length = 235 Score = 96.3 bits (238), Expect = 4e-18 Identities = 44/58 (75%), Positives = 48/58 (82%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M KVKY+LLDCDNTLC SERLAFEACADLTNE++EKH RY D LLE+FVG NFR Sbjct: 1 MPKVKYVLLDCDNTLCLSERLAFEACADLTNELLEKHGKSERYTVDKLLEEFVGQNFR 58 >gb|ETI27255.1| hypothetical protein G647_09938 [Cladophialophora carrionii CBS 160.54] Length = 248 Score = 95.9 bits (237), Expect = 5e-18 Identities = 44/58 (75%), Positives = 48/58 (82%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M KVKYILLDCDNTLC SERLAFEAC DLTNE++EK+N+ RY D LLE FVG NFR Sbjct: 1 MGKVKYILLDCDNTLCLSERLAFEACTDLTNELLEKYNVSDRYTVDDLLEAFVGQNFR 58 >gb|ETS73909.1| hypothetical protein PFICI_13775 [Pestalotiopsis fici W106-1] Length = 247 Score = 95.5 bits (236), Expect = 7e-18 Identities = 45/58 (77%), Positives = 47/58 (81%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M +VKYILLDCDNTLC SERLAFEAC DLTNEV+EK RY D LLEDFVGHNFR Sbjct: 1 MPRVKYILLDCDNTLCLSERLAFEACTDLTNEVLEKWGKPERYTVDQLLEDFVGHNFR 58 >gb|EMR71287.1| putative haloacid dehalogenase-like hydrolase protein [Eutypa lata UCREL1] Length = 248 Score = 94.4 bits (233), Expect = 1e-17 Identities = 44/58 (75%), Positives = 46/58 (79%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M + KYILLDCDNTLC SERLAFEAC DLTNEV+EK RY D LLEDFVGHNFR Sbjct: 1 MPRAKYILLDCDNTLCLSERLAFEACTDLTNEVLEKWGKSERYTVDQLLEDFVGHNFR 58 >gb|EXJ66690.1| phosphoglycolate phosphatase [Cladophialophora psammophila CBS 110553] Length = 248 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/58 (72%), Positives = 47/58 (81%) Frame = +1 Query: 82 MAKVKYILLDCDNTLCKSERLAFEACADLTNEVMEKHNIDARYNTDSLLEDFVGHNFR 255 M KVKY+LLDCDNTLC SERLAFEAC DLTNE++E +N+ RY D LLE FVG NFR Sbjct: 1 MGKVKYVLLDCDNTLCLSERLAFEACTDLTNELLEMYNVPHRYTVDGLLETFVGQNFR 58