BLASTX nr result
ID: Cocculus23_contig00041207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00041207 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635262.1| PREDICTED: G-type lectin S-receptor-like ser... 56 4e-06 ref|XP_002528881.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >ref|XP_003635262.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase B120-like [Vitis vinifera] Length = 882 Score = 56.2 bits (134), Expect = 4e-06 Identities = 33/77 (42%), Positives = 47/77 (61%) Frame = -1 Query: 231 LFFIVLCLCCPCSFCIVSTHSANSITQGQTLEVGQRLESPSQIFVLGFFAKGSSGSRYLG 52 LF + + P SFC ++AN++TQGQ++ G+ + S SQ F LGFF+ +S SRY+G Sbjct: 48 LFLLSIFYSLP-SFC----YAANTLTQGQSIRDGETVNSSSQHFALGFFSPENSTSRYVG 102 Query: 51 IWLNTNMRIGTEGEMVV 1 IW N EG+ VV Sbjct: 103 IWYNK-----IEGQTVV 114 >ref|XP_002528881.1| conserved hypothetical protein [Ricinus communis] gi|223531680|gb|EEF33505.1| conserved hypothetical protein [Ricinus communis] Length = 2428 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/61 (40%), Positives = 38/61 (62%) Frame = -1 Query: 222 IVLCLCCPCSFCIVSTHSANSITQGQTLEVGQRLESPSQIFVLGFFAKGSSGSRYLGIWL 43 I + LCC C +A+++ + +++ G+ L SPS +F LGFF+ G+S RYLGIW Sbjct: 4 IPILLCCYLLLCTTIYTAADTMNRTRSIRDGESLVSPSGVFKLGFFSPGTSKDRYLGIWY 63 Query: 42 N 40 N Sbjct: 64 N 64