BLASTX nr result
ID: Cocculus23_contig00041069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00041069 (622 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC97546.1| hypothetical protein BAUCODRAFT_456145 [Baudoinia... 120 4e-25 ref|XP_003848136.1| hypothetical protein MYCGRDRAFT_106356 [Zymo... 119 7e-25 gb|EMF08325.1| hypothetical protein SEPMUDRAFT_111681 [Sphaeruli... 117 3e-24 >gb|EMC97546.1| hypothetical protein BAUCODRAFT_456145 [Baudoinia compniacensis UAMH 10762] Length = 168 Score = 120 bits (300), Expect = 4e-25 Identities = 55/93 (59%), Positives = 69/93 (74%) Frame = -1 Query: 523 IAQLPPCPHLADPKIDAMMMPLPPDPRPSRCLRLSHPRIYGNIVSDMKDAKGCRDWRNFA 344 I++LPPC + DPKIDAMMMP+P + CLRLS P+ Y NIV MK KGCRDWRNFA Sbjct: 59 ISKLPPCSGVCDPKIDAMMMPVPAESGRGSCLRLSQPKTYSNIVDSMKACKGCRDWRNFA 118 Query: 343 VFEADEVDMSTSADEYASKKAADYEKRMSQLAS 245 VF DEVDM+ SA E A ++AA+YE+++ Q +S Sbjct: 119 VFHNDEVDMALSAVEVAQRQAANYERKLRQFSS 151 >ref|XP_003848136.1| hypothetical protein MYCGRDRAFT_106356 [Zymoseptoria tritici IPO323] gi|339468010|gb|EGP83112.1| hypothetical protein MYCGRDRAFT_106356 [Zymoseptoria tritici IPO323] Length = 158 Score = 119 bits (298), Expect = 7e-25 Identities = 53/92 (57%), Positives = 71/92 (77%) Frame = -1 Query: 523 IAQLPPCPHLADPKIDAMMMPLPPDPRPSRCLRLSHPRIYGNIVSDMKDAKGCRDWRNFA 344 I++LPPC ++PKI+AMMMP+P +PR SRCLRLS P+ Y NIV MK +GCRDWR+F Sbjct: 50 ISKLPPCNRESNPKIEAMMMPVPAEPRASRCLRLSQPKTYSNIVDSMKATRGCRDWRSFG 109 Query: 343 VFEADEVDMSTSADEYASKKAADYEKRMSQLA 248 VF ADEVDMS A++ A ++AAD E+++ L+ Sbjct: 110 VFYADEVDMSLPAEDVARRRAADCERKLRMLS 141 >gb|EMF08325.1| hypothetical protein SEPMUDRAFT_111681 [Sphaerulina musiva SO2202] Length = 164 Score = 117 bits (293), Expect = 3e-24 Identities = 52/94 (55%), Positives = 74/94 (78%) Frame = -1 Query: 523 IAQLPPCPHLADPKIDAMMMPLPPDPRPSRCLRLSHPRIYGNIVSDMKDAKGCRDWRNFA 344 I++LPPC ++DP+I+AMMMP+P + R SRCLR+SHP+IYG+IV++MK + R W++F Sbjct: 52 ISRLPPCKRVSDPQIEAMMMPMPQETRQSRCLRMSHPKIYGDIVNEMKRERKSRAWKDFQ 111 Query: 343 VFEADEVDMSTSADEYASKKAADYEKRMSQLASF 242 VF DEVDM+ SA + A+KKAA YE+ + L+SF Sbjct: 112 VFHTDEVDMTISAVDMAAKKAAQYERMVRDLSSF 145