BLASTX nr result
ID: Cocculus23_contig00040939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00040939 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224301.1| hypothetical protein PRUPE_ppa019683mg, part... 60 4e-07 ref|XP_004298201.1| PREDICTED: putative adenylate cyclase regula... 58 1e-06 ref|XP_007033830.1| LRR and NB-ARC domains-containing disease re... 57 3e-06 >ref|XP_007224301.1| hypothetical protein PRUPE_ppa019683mg, partial [Prunus persica] gi|462421237|gb|EMJ25500.1| hypothetical protein PRUPE_ppa019683mg, partial [Prunus persica] Length = 969 Score = 59.7 bits (143), Expect = 4e-07 Identities = 38/88 (43%), Positives = 47/88 (53%), Gaps = 4/88 (4%) Frame = -1 Query: 257 LKELSICECPTLQDFYAKGNSLECLTELVVRDCPNLISV----ELQGLTSLTYLEIGNCG 90 L ++SIC C L S L L +R+CPNLIS+ ++ L SL+ LEI +C Sbjct: 779 LHDVSICGCDGLTSLPRGLQSCTSLNRLTIRECPNLISLADVDDISRLHSLSSLEIADCQ 838 Query: 89 GLHSLPEDLALLPHLERLRIGPFSEELD 6 L LP L L LE L IG F EELD Sbjct: 839 KLKYLPTGLRSLTSLEYLSIGGFWEELD 866 >ref|XP_004298201.1| PREDICTED: putative adenylate cyclase regulatory protein-like [Fragaria vesca subsp. vesca] Length = 425 Score = 58.2 bits (139), Expect = 1e-06 Identities = 35/85 (41%), Positives = 49/85 (57%), Gaps = 1/85 (1%) Frame = -1 Query: 257 LKELSICECPTLQDFYAKGNSLECLTELVVRDCPNLISV-ELQGLTSLTYLEIGNCGGLH 81 L+ELS+ CP L + CL +L+++DC L S+ + + LTSL L I C G+ Sbjct: 221 LQELSVMGCPKLASITFSTDLNPCLEKLIIKDCNGLQSLPDFRSLTSLRELYIVGCAGIE 280 Query: 80 SLPEDLALLPHLERLRIGPFSEELD 6 SL L+ L LE L +GPF E+LD Sbjct: 281 SL-TGLSCLARLEDLGLGPFWEDLD 304 >ref|XP_007033830.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508712859|gb|EOY04756.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 1194 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/77 (44%), Positives = 41/77 (53%), Gaps = 1/77 (1%) Frame = -1 Query: 257 LKELSICECPTLQDFYAKGNSLECLTELVVRDCPNLISV-ELQGLTSLTYLEIGNCGGLH 81 LKEL I CP L+ CL EL + DCPNL S+ ++G +SLT L I +C GL Sbjct: 931 LKELHIQACPNLRSIPTINGLSMCLKELRIWDCPNLRSIPSIEGFSSLTDLTIKDCEGLS 990 Query: 80 SLPEDLALLPHLERLRI 30 LP L LE L I Sbjct: 991 CLPNGLESCTSLENLNI 1007