BLASTX nr result
ID: Cocculus23_contig00040914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00040914 (464 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007216777.1| hypothetical protein PRUPE_ppa024311mg [Prun... 55 8e-06 >ref|XP_007216777.1| hypothetical protein PRUPE_ppa024311mg [Prunus persica] gi|462412927|gb|EMJ17976.1| hypothetical protein PRUPE_ppa024311mg [Prunus persica] Length = 285 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = -2 Query: 451 KGFIGRLNQAMEEDWEDQMVDDALGMPAQQRCGSYRYS 338 KGFI RLN AM E W D+ VDDALGMP Q CG++ +S Sbjct: 244 KGFIQRLNGAMREKWHDRTVDDALGMPLQNLCGTFNFS 281