BLASTX nr result
ID: Cocculus23_contig00040796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00040796 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003854698.1| hypothetical protein MYCGRDRAFT_90331 [Zymos... 65 7e-09 ref|XP_007289675.1| hypothetical protein MBM_01786 [Marssonina b... 62 8e-08 gb|EKG15480.1| hypothetical protein MPH_07292 [Macrophomina phas... 59 9e-07 ref|XP_007587572.1| hypothetical protein UCRNP2_8330 [Neofusicoc... 57 2e-06 gb|EON67540.1| hypothetical protein W97_06908 [Coniosporium apol... 56 6e-06 >ref|XP_003854698.1| hypothetical protein MYCGRDRAFT_90331 [Zymoseptoria tritici IPO323] gi|339474582|gb|EGP89674.1| hypothetical protein MYCGRDRAFT_90331 [Zymoseptoria tritici IPO323] Length = 421 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/50 (58%), Positives = 38/50 (76%) Frame = +1 Query: 130 YLEAINVLYQDNIFDIRRAEALLRLPKVILPQRFQAIRQVQFSTTFRLGF 279 Y E+IN+LYQ N FD R EA+ RLP++ILPQR Q IR++ FST F++ F Sbjct: 127 YRESINLLYQSNTFDFREVEAVTRLPRIILPQRLQHIRRIHFSTAFQVPF 176 >ref|XP_007289675.1| hypothetical protein MBM_01786 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866795|gb|EKD19834.1| hypothetical protein MBM_01786 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 326 Score = 62.0 bits (149), Expect = 8e-08 Identities = 39/93 (41%), Positives = 52/93 (55%), Gaps = 16/93 (17%) Frame = +1 Query: 46 HHNKLPQE---GLPLPEGSIG---------FTLLFTCRLIYLEAINVLYQDNIFDIRRAE 189 HH++ ++ GL LP G LL TCR IY AI+VLY+ NIFD E Sbjct: 141 HHDECHEQRCRGLKLPSGLYTDRSQVQDNFLPLLQTCRKIYSSAIHVLYKSNIFDFDSME 200 Query: 190 ALLRLPKVILPQRFQAIRQV----QFSTTFRLG 276 +LLRL ILPQRF +I+++ +F +FR G Sbjct: 201 SLLRLSTTILPQRFDSIQRLSLDFRFKASFRFG 233 >gb|EKG15480.1| hypothetical protein MPH_07292 [Macrophomina phaseolina MS6] Length = 171 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/52 (55%), Positives = 34/52 (65%) Frame = +1 Query: 130 YLEAINVLYQDNIFDIRRAEALLRLPKVILPQRFQAIRQVQFSTTFRLGFTP 285 Y+EAI VLY N F +RRA++L LPKVILP R Q IR + FST F P Sbjct: 10 YIEAIGVLYTCNTFSMRRAKSLSLLPKVILPHRLQLIRNIHFSTAFACPIRP 61 >ref|XP_007587572.1| hypothetical protein UCRNP2_8330 [Neofusicoccum parvum UCRNP2] gi|485918285|gb|EOD44975.1| hypothetical protein UCRNP2_8330 [Neofusicoccum parvum UCRNP2] Length = 381 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/69 (37%), Positives = 39/69 (56%) Frame = +1 Query: 70 GLPLPEGSIGFTLLFTCRLIYLEAINVLYQDNIFDIRRAEALLRLPKVILPQRFQAIRQV 249 G LP+ ++ +LL +CR Y EAI++LY+DN+FD + + ILP R +IR + Sbjct: 187 GHSLPQSTLSISLLLSCRRAYCEAIDILYKDNVFDFNHPQTFVLFAGTILPHRLASIRSL 246 Query: 250 QFSTTFRLG 276 Q R G Sbjct: 247 QVLWAHRAG 255 >gb|EON67540.1| hypothetical protein W97_06908 [Coniosporium apollinis CBS 100218] Length = 326 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/82 (37%), Positives = 42/82 (51%) Frame = +1 Query: 34 FRMYHHNKLPQEGLPLPEGSIGFTLLFTCRLIYLEAINVLYQDNIFDIRRAEALLRLPKV 213 + +YH N LP LL TCR +Y EAI++LY N FDIRR + + L + Sbjct: 150 YSVYHDNFLP--------------LLQTCRQVYYEAIDILYTRNTFDIRRVDTFISLHES 195 Query: 214 ILPQRFQAIRQVQFSTTFRLGF 279 I+PQR +IR + F F Sbjct: 196 IIPQRSNSIRYLNLRWHFERNF 217