BLASTX nr result
ID: Cocculus23_contig00040550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00040550 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006437031.1| hypothetical protein CICLE_v10033880mg [Citr... 58 1e-06 ref|XP_006485163.1| PREDICTED: UPF0392 protein At1g27200-like [C... 55 8e-06 >ref|XP_006437031.1| hypothetical protein CICLE_v10033880mg [Citrus clementina] gi|557539227|gb|ESR50271.1| hypothetical protein CICLE_v10033880mg [Citrus clementina] Length = 589 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/59 (49%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = -2 Query: 176 SILLPDWEVLLVF-PLRXXXXXXXXSGHHQCLCIYPNNDTSPANPAGVLPFTHRPTFKC 3 S+LLPDWEVL++ P G H C++PNN TSPA +G LPFT R FKC Sbjct: 102 SVLLPDWEVLVILSPETPLMPSYSLEGFH---CLFPNNQTSPARFSGALPFTERTAFKC 157 >ref|XP_006485163.1| PREDICTED: UPF0392 protein At1g27200-like [Citrus sinensis] Length = 589 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/59 (47%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = -2 Query: 176 SILLPDWEVLLVF-PLRXXXXXXXXSGHHQCLCIYPNNDTSPANPAGVLPFTHRPTFKC 3 S+LLPDWEVL++ P G H C++ NN TSPA +G LPFT R FKC Sbjct: 102 SVLLPDWEVLVILSPENPLMPSDPLEGFH---CLFSNNQTSPARFSGALPFTERTAFKC 157