BLASTX nr result
ID: Cocculus23_contig00040435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00040435 (254 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843081.1| hypothetical protein AMTR_s00140p00022750 [A... 76 5e-12 ref|XP_007010078.1| F-box and Leucine Rich Repeat domains contai... 73 4e-11 ref|XP_002264975.2| PREDICTED: uncharacterized protein LOC100248... 72 6e-11 emb|CBI30188.3| unnamed protein product [Vitis vinifera] 72 6e-11 emb|CAN83583.1| hypothetical protein VITISV_009664 [Vitis vinifera] 72 6e-11 gb|EXB75932.1| hypothetical protein L484_022609 [Morus notabilis] 72 8e-11 ref|XP_004306171.1| PREDICTED: uncharacterized protein LOC101308... 72 1e-10 ref|XP_007204769.1| hypothetical protein PRUPE_ppa015244mg [Prun... 71 1e-10 ref|XP_002519423.1| ATSMC2, putative [Ricinus communis] gi|22354... 70 4e-10 ref|XP_006485296.1| PREDICTED: early endosome antigen 1-like [Ci... 67 2e-09 ref|XP_004516963.1| PREDICTED: myosin-9-like [Cicer arietinum] 67 2e-09 ref|XP_007145290.1| hypothetical protein PHAVU_007G226600g [Phas... 66 4e-09 ref|XP_006594170.1| PREDICTED: early endosome antigen 1-like [Gl... 66 6e-09 ref|XP_004250022.1| PREDICTED: uncharacterized protein LOC101260... 66 6e-09 ref|XP_004137997.1| PREDICTED: uncharacterized protein LOC101220... 65 7e-09 ref|XP_003590443.1| RRP1 [Medicago truncatula] gi|355479491|gb|A... 65 1e-08 gb|ABI51616.1| RRP1 [Medicago truncatula] 65 1e-08 ref|XP_006379507.1| hypothetical protein POPTR_0008s02980g [Popu... 65 1e-08 ref|XP_007027521.1| F-box and Leucine Rich Repeat domains contai... 65 1e-08 ref|XP_004246909.1| PREDICTED: uncharacterized protein LOC101267... 64 2e-08 >ref|XP_006843081.1| hypothetical protein AMTR_s00140p00022750 [Amborella trichopoda] gi|548845291|gb|ERN04756.1| hypothetical protein AMTR_s00140p00022750 [Amborella trichopoda] Length = 1537 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +2 Query: 116 LNRHNRSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 L+R EK GERVDFKFSQ+QALQVP+GWDKLFVSIIS+ETGK V Sbjct: 4 LHRQRSHEKLGERVDFKFSQLQALQVPRGWDKLFVSIISVETGKAV 49 >ref|XP_007010078.1| F-box and Leucine Rich Repeat domains containing protein, putative isoform 3, partial [Theobroma cacao] gi|508726991|gb|EOY18888.1| F-box and Leucine Rich Repeat domains containing protein, putative isoform 3, partial [Theobroma cacao] Length = 1520 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +2 Query: 131 RSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 +S+KSGER DFKFS QALQVPKGWDKLFVSIIS++TGKT+ Sbjct: 8 KSDKSGERFDFKFSSFQALQVPKGWDKLFVSIISVDTGKTI 48 >ref|XP_002264975.2| PREDICTED: uncharacterized protein LOC100248757 [Vitis vinifera] Length = 2411 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +2 Query: 128 NRSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 N++ KSGERVDFKFS QA QVPKGWDKLFVSI+S+ETGK++ Sbjct: 7 NKAAKSGERVDFKFSNFQATQVPKGWDKLFVSIVSVETGKSI 48 >emb|CBI30188.3| unnamed protein product [Vitis vinifera] Length = 1369 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +2 Query: 128 NRSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 N++ KSGERVDFKFS QA QVPKGWDKLFVSI+S+ETGK++ Sbjct: 7 NKAAKSGERVDFKFSNFQATQVPKGWDKLFVSIVSVETGKSI 48 >emb|CAN83583.1| hypothetical protein VITISV_009664 [Vitis vinifera] Length = 2427 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +2 Query: 128 NRSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 N++ KSGERVDFKFS QA QVPKGWDKLFVSI+S+ETGK++ Sbjct: 7 NKAAKSGERVDFKFSNFQATQVPKGWDKLFVSIVSVETGKSI 48 >gb|EXB75932.1| hypothetical protein L484_022609 [Morus notabilis] Length = 1390 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/46 (65%), Positives = 41/46 (89%) Frame = +2 Query: 116 LNRHNRSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 L+RH ++ KSG+++DFKFS +ALQVPKGWDKL VS++S+ETGKT+ Sbjct: 4 LHRHRQAAKSGDKLDFKFSSFKALQVPKGWDKLVVSVVSVETGKTI 49 >ref|XP_004306171.1| PREDICTED: uncharacterized protein LOC101308313 [Fragaria vesca subsp. vesca] Length = 1467 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +2 Query: 128 NRSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 NR KSGER+DFKFSQ +A+QVP+GWDKLFVSI+S+ETGK + Sbjct: 7 NRPAKSGERIDFKFSQFKAVQVPRGWDKLFVSIVSVETGKPI 48 >ref|XP_007204769.1| hypothetical protein PRUPE_ppa015244mg [Prunus persica] gi|462400300|gb|EMJ05968.1| hypothetical protein PRUPE_ppa015244mg [Prunus persica] Length = 1400 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +2 Query: 128 NRSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 NR KSGERVDFKFS +ALQVP+GWDKLFVSI+S+ETGK + Sbjct: 7 NRPAKSGERVDFKFSHFKALQVPRGWDKLFVSIVSVETGKPI 48 >ref|XP_002519423.1| ATSMC2, putative [Ricinus communis] gi|223541286|gb|EEF42837.1| ATSMC2, putative [Ricinus communis] Length = 1306 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = +2 Query: 116 LNRHNRSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 L++ + KSGER+DFKFSQ + QVPKGWDKLFVS+IS+ETGKT+ Sbjct: 4 LHKTKPAAKSGERIDFKFSQFKVHQVPKGWDKLFVSVISVETGKTI 49 >ref|XP_006485296.1| PREDICTED: early endosome antigen 1-like [Citrus sinensis] Length = 1665 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +2 Query: 128 NRSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 N+S+K GE+ DFKFS QALQVPKGWDKL VS++ +ETGKT+ Sbjct: 8 NKSDKFGEKFDFKFSHFQALQVPKGWDKLVVSVVLVETGKTI 49 >ref|XP_004516963.1| PREDICTED: myosin-9-like [Cicer arietinum] Length = 1268 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/46 (63%), Positives = 41/46 (89%) Frame = +2 Query: 116 LNRHNRSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 L++H RS KSG+R++F+ S ++ALQVPKGWDKLFVS++S+E GKT+ Sbjct: 4 LHKH-RSPKSGDRIEFRISHLKALQVPKGWDKLFVSVVSVENGKTI 48 >ref|XP_007145290.1| hypothetical protein PHAVU_007G226600g [Phaseolus vulgaris] gi|561018480|gb|ESW17284.1| hypothetical protein PHAVU_007G226600g [Phaseolus vulgaris] Length = 1341 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/46 (60%), Positives = 41/46 (89%) Frame = +2 Query: 116 LNRHNRSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 L++H R+ KSG+R++F+ S ++ALQVPKGWDKLFVS++S+E GKT+ Sbjct: 4 LHKH-RAAKSGDRIEFRISHLKALQVPKGWDKLFVSVVSVENGKTI 48 >ref|XP_006594170.1| PREDICTED: early endosome antigen 1-like [Glycine max] Length = 1391 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/46 (60%), Positives = 41/46 (89%) Frame = +2 Query: 116 LNRHNRSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 L++H R KSG++++F+ S ++ALQVPKGWDKLFVS++S+ETGKT+ Sbjct: 4 LHKH-RIAKSGDKIEFRISHLKALQVPKGWDKLFVSVVSVETGKTI 48 >ref|XP_004250022.1| PREDICTED: uncharacterized protein LOC101260002 [Solanum lycopersicum] Length = 1473 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +2 Query: 134 SEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 SEKSG R DF FS +QA QVPKGWDKL VS+IS+ETGKTV Sbjct: 21 SEKSGHRFDFSFSNLQARQVPKGWDKLSVSLISVETGKTV 60 >ref|XP_004137997.1| PREDICTED: uncharacterized protein LOC101220815 [Cucumis sativus] Length = 1314 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 128 NRSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 NR KSGE+ DFKFS +A QVPKGWDKLFVS+IS +TGK + Sbjct: 7 NRHAKSGEKFDFKFSNFKATQVPKGWDKLFVSVISEQTGKAI 48 >ref|XP_003590443.1| RRP1 [Medicago truncatula] gi|355479491|gb|AES60694.1| RRP1 [Medicago truncatula] Length = 1345 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/46 (60%), Positives = 40/46 (86%) Frame = +2 Query: 116 LNRHNRSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 L++H RS KS +R++F+ S ++ALQVPKGWDKLFVS++S+E GKT+ Sbjct: 4 LHKH-RSAKSSDRIEFRISHLKALQVPKGWDKLFVSVVSVENGKTI 48 >gb|ABI51616.1| RRP1 [Medicago truncatula] Length = 1228 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/46 (60%), Positives = 40/46 (86%) Frame = +2 Query: 116 LNRHNRSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 L++H RS KS +R++F+ S ++ALQVPKGWDKLFVS++S+E GKT+ Sbjct: 4 LHKH-RSAKSSDRIEFRISHLKALQVPKGWDKLFVSVVSVENGKTI 48 >ref|XP_006379507.1| hypothetical protein POPTR_0008s02980g [Populus trichocarpa] gi|550332301|gb|ERP57304.1| hypothetical protein POPTR_0008s02980g [Populus trichocarpa] Length = 1566 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = +2 Query: 116 LNRHNRSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 L++H +S+K G +DFKFS QALQVPKGWD+LFV IIS+ETGKT+ Sbjct: 4 LHKH-KSDKFGGTLDFKFSSFQALQVPKGWDRLFVYIISVETGKTL 48 >ref|XP_007027521.1| F-box and Leucine Rich Repeat domains containing protein, putative isoform 1 [Theobroma cacao] gi|508716126|gb|EOY08023.1| F-box and Leucine Rich Repeat domains containing protein, putative isoform 1 [Theobroma cacao] Length = 1451 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +2 Query: 131 RSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 R KSGE++DF+FS +A+QVPKGWD+LF+SIIS+E GKT+ Sbjct: 56 RPTKSGEKIDFRFSNFKAVQVPKGWDRLFMSIISVENGKTI 96 >ref|XP_004246909.1| PREDICTED: uncharacterized protein LOC101267051 [Solanum lycopersicum] Length = 1168 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +2 Query: 131 RSEKSGERVDFKFSQIQALQVPKGWDKLFVSIISMETGKTV 253 + +KSGERVDF+FS Q LQVPKGWD+L +S+I +ETGKTV Sbjct: 10 KQDKSGERVDFRFSNFQLLQVPKGWDRLSLSVICVETGKTV 50