BLASTX nr result
ID: Cocculus23_contig00040182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00040182 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136408.1| PREDICTED: pentatricopeptide repeat-containi... 119 3e-25 ref|XP_004295870.1| PREDICTED: pentatricopeptide repeat-containi... 119 6e-25 ref|XP_002310592.2| pentatricopeptide repeat-containing family p... 117 2e-24 ref|XP_002324235.2| pentatricopeptide repeat-containing family p... 117 2e-24 ref|XP_007013366.1| Pentatricopeptide repeat-containing protein,... 115 6e-24 ref|XP_004981586.1| PREDICTED: pentatricopeptide repeat-containi... 115 8e-24 ref|XP_002272690.2| PREDICTED: pentatricopeptide repeat-containi... 115 8e-24 ref|XP_002463808.1| hypothetical protein SORBIDRAFT_01g006560 [S... 115 8e-24 emb|CBI30808.3| unnamed protein product [Vitis vinifera] 115 8e-24 ref|XP_006651864.1| PREDICTED: pentatricopeptide repeat-containi... 114 1e-23 ref|XP_006382375.1| hypothetical protein POPTR_0005s01560g [Popu... 114 1e-23 ref|XP_007020191.1| Tetratricopeptide repeat (TPR)-like superfam... 114 1e-23 ref|XP_004288820.1| PREDICTED: pentatricopeptide repeat-containi... 114 1e-23 emb|CBI39605.3| unnamed protein product [Vitis vinifera] 114 1e-23 ref|XP_002281942.1| PREDICTED: pentatricopeptide repeat-containi... 114 1e-23 emb|CAN61593.1| hypothetical protein VITISV_030555 [Vitis vinifera] 114 1e-23 ref|NP_001049485.1| Os03g0235200 [Oryza sativa Japonica Group] g... 114 1e-23 gb|EYU31065.1| hypothetical protein MIMGU_mgv1a025575mg [Mimulus... 114 1e-23 ref|XP_006475804.1| PREDICTED: pentatricopeptide repeat-containi... 114 1e-23 ref|XP_006450982.1| hypothetical protein CICLE_v10010823mg [Citr... 114 1e-23 >ref|XP_004136408.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Cucumis sativus] Length = 632 Score = 119 bits (299), Expect = 3e-25 Identities = 51/68 (75%), Positives = 62/68 (91%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLA+AFGLI+T+EGTT+ I+KNLR+C DCH AIK+IS+IV+REI+VRDR RFHHFKDG Sbjct: 565 SEKLALAFGLINTSEGTTIRIVKNLRVCNDCHDAIKIISKIVEREIVVRDRSRFHHFKDG 624 Query: 212 TCSCKDFW 189 CSC D+W Sbjct: 625 KCSCNDYW 632 >ref|XP_004295870.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Fragaria vesca subsp. vesca] Length = 729 Score = 119 bits (297), Expect = 6e-25 Identities = 53/68 (77%), Positives = 60/68 (88%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLA+AFGLIST+ GTT+ I+KNLRIC DCH A KLIS+IV+REIIVRDR RFHHFKDG Sbjct: 662 SEKLAIAFGLISTSPGTTIRIVKNLRICNDCHDATKLISKIVEREIIVRDRSRFHHFKDG 721 Query: 212 TCSCKDFW 189 CSC D+W Sbjct: 722 KCSCNDYW 729 >ref|XP_002310592.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550334248|gb|EEE91042.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 785 Score = 117 bits (292), Expect = 2e-24 Identities = 51/68 (75%), Positives = 60/68 (88%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLA+AFG+IST E TTL I+KNLR+C DCH+AIK IS++V REIIVRD RFHHFKDG Sbjct: 718 SEKLAIAFGIISTPENTTLRIMKNLRVCNDCHNAIKFISKLVDREIIVRDATRFHHFKDG 777 Query: 212 TCSCKDFW 189 +CSCKD+W Sbjct: 778 SCSCKDYW 785 >ref|XP_002324235.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550317719|gb|EEF02800.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 736 Score = 117 bits (292), Expect = 2e-24 Identities = 52/68 (76%), Positives = 60/68 (88%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLA+AFGLIST GTT+ I+KNLR+CG+CHSA KLIS+I REII RDR RFHHFKDG Sbjct: 669 SEKLAIAFGLISTKPGTTIRIMKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDG 728 Query: 212 TCSCKDFW 189 +CSCKD+W Sbjct: 729 SCSCKDYW 736 >ref|XP_007013366.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508783729|gb|EOY30985.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 194 Score = 115 bits (288), Expect = 6e-24 Identities = 51/68 (75%), Positives = 59/68 (86%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLA+AFGLIST GTT+ I+KNLR+CG+CHSA KLIS+I +EII RDR RFHHFKDG Sbjct: 127 SEKLAIAFGLISTKPGTTIRIVKNLRVCGNCHSATKLISKIFNKEIIARDRNRFHHFKDG 186 Query: 212 TCSCKDFW 189 CSCKD+W Sbjct: 187 FCSCKDYW 194 >ref|XP_004981586.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Setaria italica] Length = 803 Score = 115 bits (287), Expect = 8e-24 Identities = 51/68 (75%), Positives = 59/68 (86%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLA+AFGLIST E TTL I+KNLR+C DCH AIK IS++V+REIIVRD RFHHF+DG Sbjct: 736 SEKLAIAFGLISTPEKTTLRIMKNLRVCNDCHMAIKFISKVVEREIIVRDATRFHHFRDG 795 Query: 212 TCSCKDFW 189 CSCKD+W Sbjct: 796 FCSCKDYW 803 >ref|XP_002272690.2| PREDICTED: pentatricopeptide repeat-containing protein At5g46460, mitochondrial [Vitis vinifera] Length = 676 Score = 115 bits (287), Expect = 8e-24 Identities = 49/68 (72%), Positives = 61/68 (89%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SE+LA+ FGLIST EG+T+T++KNLR+CGDCHSAIKLI++IV+R+IIVRD RFHHF DG Sbjct: 609 SERLAIGFGLISTVEGSTITVMKNLRVCGDCHSAIKLIAKIVRRKIIVRDSTRFHHFMDG 668 Query: 212 TCSCKDFW 189 CSC D+W Sbjct: 669 RCSCGDYW 676 >ref|XP_002463808.1| hypothetical protein SORBIDRAFT_01g006560 [Sorghum bicolor] gi|241917662|gb|EER90806.1| hypothetical protein SORBIDRAFT_01g006560 [Sorghum bicolor] Length = 803 Score = 115 bits (287), Expect = 8e-24 Identities = 51/68 (75%), Positives = 59/68 (86%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLA+AFGLIST E TTL I+KNLR+C DCH+AIK IS++V REIIVRD RFHHF+DG Sbjct: 736 SEKLAIAFGLISTPEKTTLRIMKNLRVCNDCHTAIKFISKVVDREIIVRDATRFHHFRDG 795 Query: 212 TCSCKDFW 189 CSCKD+W Sbjct: 796 YCSCKDYW 803 >emb|CBI30808.3| unnamed protein product [Vitis vinifera] Length = 660 Score = 115 bits (287), Expect = 8e-24 Identities = 49/68 (72%), Positives = 61/68 (89%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SE+LA+ FGLIST EG+T+T++KNLR+CGDCHSAIKLI++IV+R+IIVRD RFHHF DG Sbjct: 593 SERLAIGFGLISTVEGSTITVMKNLRVCGDCHSAIKLIAKIVRRKIIVRDSTRFHHFMDG 652 Query: 212 TCSCKDFW 189 CSC D+W Sbjct: 653 RCSCGDYW 660 >ref|XP_006651864.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like, partial [Oryza brachyantha] Length = 761 Score = 114 bits (286), Expect = 1e-23 Identities = 50/68 (73%), Positives = 58/68 (85%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLA+AFGLIST E TTL I+KNLR+C DCH+AIK +SR+ REIIVRD RFHHF+DG Sbjct: 694 SEKLAIAFGLISTPEKTTLRIMKNLRVCNDCHTAIKFVSRVTDREIIVRDATRFHHFRDG 753 Query: 212 TCSCKDFW 189 CSCKD+W Sbjct: 754 LCSCKDYW 761 >ref|XP_006382375.1| hypothetical protein POPTR_0005s01560g [Populus trichocarpa] gi|550337735|gb|ERP60172.1| hypothetical protein POPTR_0005s01560g [Populus trichocarpa] Length = 545 Score = 114 bits (286), Expect = 1e-23 Identities = 50/68 (73%), Positives = 59/68 (86%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLA+AFGLI+T GTT+ ++KNLR+C DCHSA KLIS++ REIIVRDR R+HHFK G Sbjct: 478 SEKLAIAFGLINTKPGTTIHVVKNLRMCEDCHSAFKLISQVYDREIIVRDRARYHHFKTG 537 Query: 212 TCSCKDFW 189 TCSCKDFW Sbjct: 538 TCSCKDFW 545 >ref|XP_007020191.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508725519|gb|EOY17416.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 574 Score = 114 bits (286), Expect = 1e-23 Identities = 51/68 (75%), Positives = 60/68 (88%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLAVAFGLIST EGT + +IKNLRICGDCH IK IS+I +REIIVRDR+RFH F+DG Sbjct: 507 SEKLAVAFGLISTNEGTPIQVIKNLRICGDCHVVIKHISKIYEREIIVRDRVRFHRFRDG 566 Query: 212 TCSCKDFW 189 +CSC+D+W Sbjct: 567 SCSCRDYW 574 >ref|XP_004288820.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] Length = 659 Score = 114 bits (286), Expect = 1e-23 Identities = 50/68 (73%), Positives = 59/68 (86%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLA+AFGLIST GTT+ ++KNLR+C DCH+A KLIS++ REIIVRDR RFH FKDG Sbjct: 592 SEKLAIAFGLISTNPGTTIRVVKNLRVCSDCHTATKLISKVYNREIIVRDRNRFHQFKDG 651 Query: 212 TCSCKDFW 189 +CSCKDFW Sbjct: 652 SCSCKDFW 659 >emb|CBI39605.3| unnamed protein product [Vitis vinifera] Length = 624 Score = 114 bits (286), Expect = 1e-23 Identities = 49/68 (72%), Positives = 60/68 (88%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLA+ FGLI+T+ GTT+ I+KNLR+C DCHSA KLIS++ REIIVRDRIR+HHF++G Sbjct: 557 SEKLAIGFGLINTSPGTTIRIVKNLRVCEDCHSATKLISQVYNREIIVRDRIRYHHFRNG 616 Query: 212 TCSCKDFW 189 CSCKDFW Sbjct: 617 ACSCKDFW 624 >ref|XP_002281942.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910 isoform 1 [Vitis vinifera] Length = 672 Score = 114 bits (286), Expect = 1e-23 Identities = 49/68 (72%), Positives = 60/68 (88%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLA+ FGLI+T+ GTT+ I+KNLR+C DCHSA KLIS++ REIIVRDRIR+HHF++G Sbjct: 605 SEKLAIGFGLINTSPGTTIRIVKNLRVCEDCHSATKLISQVYNREIIVRDRIRYHHFRNG 664 Query: 212 TCSCKDFW 189 CSCKDFW Sbjct: 665 ACSCKDFW 672 >emb|CAN61593.1| hypothetical protein VITISV_030555 [Vitis vinifera] Length = 673 Score = 114 bits (286), Expect = 1e-23 Identities = 49/68 (72%), Positives = 60/68 (88%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLA+ FGLI+T+ GTT+ I+KNLR+C DCHSA KLIS++ REIIVRDRIR+HHF++G Sbjct: 606 SEKLAIGFGLINTSPGTTIRIVKNLRVCEDCHSATKLISQVYNREIIVRDRIRYHHFRNG 665 Query: 212 TCSCKDFW 189 CSCKDFW Sbjct: 666 ACSCKDFW 673 >ref|NP_001049485.1| Os03g0235200 [Oryza sativa Japonica Group] gi|108707037|gb|ABF94832.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica Group] gi|113547956|dbj|BAF11399.1| Os03g0235200 [Oryza sativa Japonica Group] gi|125585525|gb|EAZ26189.1| hypothetical protein OsJ_10058 [Oryza sativa Japonica Group] gi|215706461|dbj|BAG93317.1| unnamed protein product [Oryza sativa Japonica Group] Length = 641 Score = 114 bits (286), Expect = 1e-23 Identities = 50/68 (73%), Positives = 61/68 (89%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SE+LAVAFG+I+T EG+ + + KNLRICGDCH+AIKLIS+IVQR+IIVRD RFHHFKDG Sbjct: 574 SERLAVAFGIIATPEGSPIKVFKNLRICGDCHAAIKLISQIVQRDIIVRDSNRFHHFKDG 633 Query: 212 TCSCKDFW 189 CSC+D+W Sbjct: 634 ICSCRDYW 641 >gb|EYU31065.1| hypothetical protein MIMGU_mgv1a025575mg [Mimulus guttatus] Length = 783 Score = 114 bits (285), Expect = 1e-23 Identities = 50/68 (73%), Positives = 60/68 (88%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLA+AFGL+ST +GTTL I+KNLR+C DCHSAIK IS++V REIIVRD RFHHFK+G Sbjct: 716 SEKLAIAFGLMSTPDGTTLRIMKNLRVCNDCHSAIKFISKLVGREIIVRDATRFHHFKNG 775 Query: 212 TCSCKDFW 189 CSC+D+W Sbjct: 776 LCSCRDYW 783 >ref|XP_006475804.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Citrus sinensis] Length = 736 Score = 114 bits (285), Expect = 1e-23 Identities = 50/68 (73%), Positives = 58/68 (85%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLA+A+GLIST GTT+ I+KNLR+CG+CHSA KLIS+I REII RDR RFHHFKDG Sbjct: 669 SEKLAIAYGLISTKPGTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDG 728 Query: 212 TCSCKDFW 189 CSC D+W Sbjct: 729 NCSCNDYW 736 >ref|XP_006450982.1| hypothetical protein CICLE_v10010823mg [Citrus clementina] gi|557554208|gb|ESR64222.1| hypothetical protein CICLE_v10010823mg [Citrus clementina] Length = 736 Score = 114 bits (285), Expect = 1e-23 Identities = 50/68 (73%), Positives = 58/68 (85%) Frame = -3 Query: 392 SEKLAVAFGLISTAEGTTLTIIKNLRICGDCHSAIKLISRIVQREIIVRDRIRFHHFKDG 213 SEKLA+A+GLIST GTT+ I+KNLR+CG+CHSA KLIS+I REII RDR RFHHFKDG Sbjct: 669 SEKLAIAYGLISTKPGTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDG 728 Query: 212 TCSCKDFW 189 CSC D+W Sbjct: 729 NCSCNDYW 736