BLASTX nr result
ID: Cocculus23_contig00039065
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00039065 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 65 8e-09 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 65.5 bits (158), Expect = 8e-09 Identities = 35/68 (51%), Positives = 41/68 (60%) Frame = +3 Query: 90 GSESQRLVVLPLSRTGGCRCSVKPASRGALHSKTHEASAFARAT*AILSTWPGRAS*SCH 269 G +LV+LPL R GGCRCSVKPASR AL S+ AFA+ A LS W GRA H Sbjct: 13 GLGRHQLVILPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQGHIAQLSAWNGRARAQPH 72 Query: 270 RTQPIRSE 293 + +P E Sbjct: 73 QGRPTGPE 80