BLASTX nr result
ID: Cocculus23_contig00038352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00038352 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006489135.1| PREDICTED: acyl-CoA-binding domain-containin... 66 4e-09 ref|XP_006419645.1| hypothetical protein CICLE_v10004439mg [Citr... 66 4e-09 ref|XP_003550179.1| PREDICTED: acyl-CoA-binding domain-containin... 65 8e-09 ref|XP_003593967.1| Acyl-CoA-binding domain-containing protein [... 65 1e-08 ref|XP_002516884.1| acyl-CoA binding protein, putative [Ricinus ... 65 1e-08 ref|XP_006380198.1| hypothetical protein POPTR_0008s22830g [Popu... 65 1e-08 ref|XP_006597533.1| PREDICTED: acyl-CoA-binding domain-containin... 65 1e-08 ref|XP_006597532.1| PREDICTED: acyl-CoA-binding domain-containin... 65 1e-08 ref|XP_004486044.1| PREDICTED: acyl-CoA-binding domain-containin... 64 2e-08 ref|XP_004486043.1| PREDICTED: acyl-CoA-binding domain-containin... 64 2e-08 ref|XP_004134196.1| PREDICTED: acyl-CoA-binding domain-containin... 64 3e-08 ref|XP_007154239.1| hypothetical protein PHAVU_003G102100g [Phas... 63 4e-08 ref|XP_007147881.1| hypothetical protein PHAVU_006G162800g [Phas... 63 4e-08 ref|XP_006342766.1| PREDICTED: acyl-CoA-binding domain-containin... 62 8e-08 ref|XP_006342764.1| PREDICTED: acyl-CoA-binding domain-containin... 62 8e-08 ref|XP_002315566.1| hypothetical protein POPTR_0010s02240g [Popu... 62 8e-08 ref|XP_004296810.1| PREDICTED: acyl-CoA-binding domain-containin... 62 1e-07 ref|XP_007035509.1| Galactose oxidase/kelch repeat superfamily p... 61 1e-07 ref|XP_007035508.1| Galactose oxidase/kelch repeat superfamily p... 61 1e-07 ref|XP_007035506.1| Galactose oxidase/kelch repeat superfamily p... 61 1e-07 >ref|XP_006489135.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Citrus sinensis] Length = 717 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKK LLVGGKTD +G++ +SV TFDTET+CWS+++AKGD+P Sbjct: 155 WGKKVLLVGGKTD-SGSDRVSVWTFDTETECWSVVEAKGDIP 195 >ref|XP_006419645.1| hypothetical protein CICLE_v10004439mg [Citrus clementina] gi|557521518|gb|ESR32885.1| hypothetical protein CICLE_v10004439mg [Citrus clementina] Length = 717 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKK LLVGGKTD +G++ +SV TFDTET+CWS+++AKGD+P Sbjct: 155 WGKKVLLVGGKTD-SGSDRVSVWTFDTETECWSVVEAKGDIP 195 >ref|XP_003550179.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Glycine max] Length = 708 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKKALL+GGKTD G++ ISV FDTET+CWSL++AKGD+P Sbjct: 149 WGKKALLIGGKTD-PGSDRISVWAFDTETECWSLMEAKGDIP 189 >ref|XP_003593967.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula] gi|355483015|gb|AES64218.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula] Length = 764 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WG+KALL+GGKTD +G + ISV FDTET+CWSLI+AKGD+P Sbjct: 155 WGQKALLIGGKTD-SGIDKISVWAFDTETECWSLIEAKGDIP 195 >ref|XP_002516884.1| acyl-CoA binding protein, putative [Ricinus communis] gi|223543972|gb|EEF45498.1| acyl-CoA binding protein, putative [Ricinus communis] Length = 713 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKKALL+GGKTD + T+ ISV FDTET+CWSL++AKGD+P Sbjct: 156 WGKKALLIGGKTDPS-TDRISVWAFDTETECWSLLEAKGDVP 196 >ref|XP_006380198.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa] gi|550333719|gb|ERP57995.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa] Length = 707 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKKALL+GGKTD A ISV FDTET+CWSL++AKGD+P Sbjct: 160 WGKKALLIGGKTDPASDR-ISVWAFDTETECWSLVEAKGDIP 200 >ref|XP_006597533.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform X2 [Glycine max] Length = 711 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKKALL+GGKTD A + ISV FDTET+CWSL++AKGD+P Sbjct: 151 WGKKALLIGGKTDPASDK-ISVWAFDTETECWSLMEAKGDIP 191 >ref|XP_006597532.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform X1 [Glycine max] Length = 715 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKKALL+GGKTD A + ISV FDTET+CWSL++AKGD+P Sbjct: 151 WGKKALLIGGKTDPASDK-ISVWAFDTETECWSLMEAKGDIP 191 >ref|XP_004486044.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform X2 [Cicer arietinum] Length = 610 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKKALL+GGKTD G++ ISV FDTET+CW+L++AKGD+P Sbjct: 55 WGKKALLIGGKTD-LGSDKISVWAFDTETECWALMEAKGDIP 95 >ref|XP_004486043.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform X1 [Cicer arietinum] Length = 709 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKKALL+GGKTD G++ ISV FDTET+CW+L++AKGD+P Sbjct: 154 WGKKALLIGGKTD-LGSDKISVWAFDTETECWALMEAKGDIP 194 >ref|XP_004134196.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Cucumis sativus] gi|449529842|ref|XP_004171907.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Cucumis sativus] Length = 678 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKKALLVGGKT+ G E ++V FDTET+CWSL++AKGD+P Sbjct: 155 WGKKALLVGGKTE-PGNERVAVWAFDTETECWSLMEAKGDIP 195 >ref|XP_007154239.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris] gi|561027593|gb|ESW26233.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris] Length = 709 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKKALL+GGKTD G++ ISV DTET+CWSL++AKGD+P Sbjct: 151 WGKKALLIGGKTD-PGSDRISVWALDTETECWSLMEAKGDIP 191 >ref|XP_007147881.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris] gi|561021104|gb|ESW19875.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris] Length = 710 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKK LL+GGKTD A + ISV FDTET+CWSL++AKGD+P Sbjct: 152 WGKKTLLIGGKTDPASDK-ISVWVFDTETECWSLMEAKGDIP 192 >ref|XP_006342766.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform X3 [Solanum tuberosum] Length = 662 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKK L+VGGKTD + +E +SV FDTET+CWSL++AKGD+P Sbjct: 149 WGKKILMVGGKTDPS-SEKVSVWAFDTETECWSLLEAKGDVP 189 >ref|XP_006342764.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform X1 [Solanum tuberosum] gi|565351643|ref|XP_006342765.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform X2 [Solanum tuberosum] Length = 701 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKK L+VGGKTD + +E +SV FDTET+CWSL++AKGD+P Sbjct: 149 WGKKILMVGGKTDPS-SEKVSVWAFDTETECWSLLEAKGDVP 189 >ref|XP_002315566.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa] gi|222864606|gb|EEF01737.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa] Length = 663 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKKALL+GGKTD A ISV F TET+CWS+I+AKGD+P Sbjct: 159 WGKKALLIGGKTDPASDR-ISVWAFHTETECWSIIEAKGDIP 199 >ref|XP_004296810.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Fragaria vesca subsp. vesca] Length = 707 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKKALLVGGKT+ G++ ISV FDTET+CWS ++AKGD+P Sbjct: 153 WGKKALLVGGKTE-PGSDKISVWAFDTETECWSHMEAKGDIP 193 >ref|XP_007035509.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 [Theobroma cacao] gi|508714538|gb|EOY06435.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 [Theobroma cacao] Length = 701 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKKALLVGG+TD G + +SV FDTET+CWS+++AKG++P Sbjct: 155 WGKKALLVGGRTD-PGNDRVSVWAFDTETECWSVMEAKGEIP 195 >ref|XP_007035508.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, partial [Theobroma cacao] gi|508714537|gb|EOY06434.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, partial [Theobroma cacao] Length = 679 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKKALLVGG+TD G + +SV FDTET+CWS+++AKG++P Sbjct: 155 WGKKALLVGGRTD-PGNDRVSVWAFDTETECWSVMEAKGEIP 195 >ref|XP_007035506.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 [Theobroma cacao] gi|590660844|ref|XP_007035507.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 [Theobroma cacao] gi|508714535|gb|EOY06432.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 [Theobroma cacao] gi|508714536|gb|EOY06433.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 [Theobroma cacao] Length = 716 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = -3 Query: 326 WGKKALLVGGKTDHAGTE*ISV*TFDTETDCWSLIKAKGDMP 201 WGKKALLVGG+TD G + +SV FDTET+CWS+++AKG++P Sbjct: 155 WGKKALLVGGRTD-PGNDRVSVWAFDTETECWSVMEAKGEIP 195