BLASTX nr result
ID: Cocculus23_contig00037378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00037378 (475 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007019658.1| Uncharacterized protein TCM_035820 [Theobrom... 79 8e-13 >ref|XP_007019658.1| Uncharacterized protein TCM_035820 [Theobroma cacao] gi|508724986|gb|EOY16883.1| Uncharacterized protein TCM_035820 [Theobroma cacao] Length = 76 Score = 78.6 bits (192), Expect = 8e-13 Identities = 31/39 (79%), Positives = 32/39 (82%) Frame = -2 Query: 306 HNRAGNNGWHRSLSHARRCCCWMSWFWGAMILLSGTIEG 190 H + N GWHRSL HARRCCCWM WFWGAMILL GTIEG Sbjct: 21 HKQIRNKGWHRSLLHARRCCCWMPWFWGAMILLPGTIEG 59