BLASTX nr result
ID: Cocculus23_contig00037310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00037310 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135303.1| PREDICTED: uncharacterized membrane protein ... 56 6e-06 >ref|XP_004135303.1| PREDICTED: uncharacterized membrane protein YuiD-like [Cucumis sativus] gi|449494875|ref|XP_004159671.1| PREDICTED: uncharacterized membrane protein YuiD-like [Cucumis sativus] Length = 176 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +1 Query: 202 SSLPSAILVNYPLISALIAFFVAQSTKFFISWYKER 309 SS S I NYPLISAL+AF +AQS KFF SWYKER Sbjct: 21 SSFSSTIFTNYPLISALLAFAIAQSIKFFTSWYKER 56