BLASTX nr result
ID: Cocculus23_contig00037306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00037306 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279773.2| PREDICTED: regulator of telomere elongation ... 166 4e-39 emb|CBI36156.3| unnamed protein product [Vitis vinifera] 166 4e-39 ref|XP_002298143.2| helicase-related family protein [Populus tri... 155 7e-36 gb|EYU21548.1| hypothetical protein MIMGU_mgv1a017765mg [Mimulus... 153 2e-35 ref|XP_004302912.1| PREDICTED: regulator of telomere elongation ... 151 8e-35 ref|XP_004235709.1| PREDICTED: regulator of telomere elongation ... 150 2e-34 ref|XP_007217426.1| hypothetical protein PRUPE_ppa027152mg [Prun... 149 3e-34 ref|XP_007024117.1| Regulator of telomere elongation helicase 1 ... 147 1e-33 ref|XP_007024116.1| Regulator of telomere elongation helicase 1 ... 147 1e-33 ref|XP_006595137.1| PREDICTED: regulator of telomere elongation ... 147 2e-33 ref|XP_004171721.1| PREDICTED: regulator of telomere elongation ... 147 2e-33 ref|XP_004141849.1| PREDICTED: regulator of telomere elongation ... 147 2e-33 ref|XP_002528200.1| regulator of telomere elongation helicase 1 ... 146 3e-33 gb|EXB74483.1| Regulator of telomere elongation helicase 1 [Moru... 145 4e-33 ref|XP_004486727.1| PREDICTED: regulator of telomere elongation ... 145 6e-33 ref|XP_004486726.1| PREDICTED: regulator of telomere elongation ... 145 6e-33 ref|XP_007150664.1| hypothetical protein PHAVU_005G171300g [Phas... 145 7e-33 ref|XP_003597782.1| Regulator of telomere elongation helicase [M... 145 7e-33 ref|XP_003597775.1| Regulator of telomere elongation helicase [M... 145 7e-33 gb|EPS57615.1| hypothetical protein M569_17202, partial [Genlise... 140 1e-31 >ref|XP_002279773.2| PREDICTED: regulator of telomere elongation helicase 1-like [Vitis vinifera] Length = 1084 Score = 166 bits (419), Expect = 4e-39 Identities = 76/96 (79%), Positives = 87/96 (90%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 R+NGPCPYY+SR+LHKVVDILF PYNYLIDR NR+SLSV W +S+LIFDEAHNLE +CAD Sbjct: 195 RSNGPCPYYVSRELHKVVDILFAPYNYLIDRGNRKSLSVCWNNSILIFDEAHNLEGLCAD 254 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRKAIEKSNE 2 AASFDLPS LLTAC+SEAK CVDLSI R+ IEK+N+ Sbjct: 255 AASFDLPSWLLTACISEAKNCVDLSISRREIEKAND 290 >emb|CBI36156.3| unnamed protein product [Vitis vinifera] Length = 777 Score = 166 bits (419), Expect = 4e-39 Identities = 76/96 (79%), Positives = 87/96 (90%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 R+NGPCPYY+SR+LHKVVDILF PYNYLIDR NR+SLSV W +S+LIFDEAHNLE +CAD Sbjct: 173 RSNGPCPYYVSRELHKVVDILFAPYNYLIDRGNRKSLSVCWNNSILIFDEAHNLEGLCAD 232 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRKAIEKSNE 2 AASFDLPS LLTAC+SEAK CVDLSI R+ IEK+N+ Sbjct: 233 AASFDLPSWLLTACISEAKNCVDLSISRREIEKAND 268 >ref|XP_002298143.2| helicase-related family protein [Populus trichocarpa] gi|550347581|gb|EEE82948.2| helicase-related family protein [Populus trichocarpa] Length = 748 Score = 155 bits (391), Expect = 7e-36 Identities = 72/96 (75%), Positives = 86/96 (89%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 RT GPCPYY+SR+LHKVVDILF PYNYLIDR NR+SL++ W +S+LIFDEAHNLES+CAD Sbjct: 194 RTFGPCPYYISRELHKVVDILFAPYNYLIDRGNRKSLAIDWDNSILIFDEAHNLESLCAD 253 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRKAIEKSNE 2 AASFDLPS LLTAC+SEAK C+DLS+ R+ E+SN+ Sbjct: 254 AASFDLPSWLLTACISEAKSCIDLSVTRR--EESND 287 >gb|EYU21548.1| hypothetical protein MIMGU_mgv1a017765mg [Mimulus guttatus] Length = 1031 Score = 153 bits (387), Expect = 2e-35 Identities = 69/89 (77%), Positives = 82/89 (92%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 R++GPCPYYLSRDLHK VDILF PYNYLIDR NR+SL + W++S+LIFDEAHNLES+CAD Sbjct: 192 RSSGPCPYYLSRDLHKDVDILFAPYNYLIDRGNRKSLKIDWQNSILIFDEAHNLESLCAD 251 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRK 23 AASFDLP+ LLTAC+SEA+KC+DLSI R+ Sbjct: 252 AASFDLPASLLTACISEAQKCIDLSITRR 280 >ref|XP_004302912.1| PREDICTED: regulator of telomere elongation helicase 1-like [Fragaria vesca subsp. vesca] Length = 1045 Score = 151 bits (382), Expect = 8e-35 Identities = 68/87 (78%), Positives = 79/87 (90%) Frame = -3 Query: 283 NGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICADAA 104 +GPCPYYLSRDLHK+VDI F PYNYLIDR R+SL + WK+S+LIFDEAHNLESICADAA Sbjct: 197 SGPCPYYLSRDLHKIVDIFFAPYNYLIDRGFRKSLQINWKNSILIFDEAHNLESICADAA 256 Query: 103 SFDLPSGLLTACVSEAKKCVDLSIKRK 23 SFDLPS LLTAC+SEAK C+DLS++R+ Sbjct: 257 SFDLPSWLLTACISEAKNCIDLSVQRR 283 >ref|XP_004235709.1| PREDICTED: regulator of telomere elongation helicase 1-like [Solanum lycopersicum] Length = 1036 Score = 150 bits (378), Expect = 2e-34 Identities = 67/89 (75%), Positives = 81/89 (91%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 R++GPCPYY+SR+LHK VDILF PYNYLIDR R+SL++ W +S+LIFDEAHNLES+CAD Sbjct: 193 RSSGPCPYYVSRELHKTVDILFAPYNYLIDRGYRKSLNIQWTNSILIFDEAHNLESLCAD 252 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRK 23 AASFDL SGLLTAC+SEAK C+DLSI+R+ Sbjct: 253 AASFDLSSGLLTACISEAKNCIDLSIERR 281 >ref|XP_007217426.1| hypothetical protein PRUPE_ppa027152mg [Prunus persica] gi|462413576|gb|EMJ18625.1| hypothetical protein PRUPE_ppa027152mg [Prunus persica] Length = 758 Score = 149 bits (377), Expect = 3e-34 Identities = 70/89 (78%), Positives = 78/89 (87%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 R GPCPYYLSR+LHKVVDILF PYNYLID R+SL + WK+S+LIFDEAHNLESICAD Sbjct: 198 RKLGPCPYYLSRELHKVVDILFAPYNYLIDHGYRKSLQIDWKNSILIFDEAHNLESICAD 257 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRK 23 AASFDLPS LLTAC SEAK C+DLS+KR+ Sbjct: 258 AASFDLPSWLLTACTSEAKNCIDLSMKRR 286 >ref|XP_007024117.1| Regulator of telomere elongation helicase 1 rtel1, putative isoform 2 [Theobroma cacao] gi|508779483|gb|EOY26739.1| Regulator of telomere elongation helicase 1 rtel1, putative isoform 2 [Theobroma cacao] Length = 992 Score = 147 bits (371), Expect = 1e-33 Identities = 71/96 (73%), Positives = 82/96 (85%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 R GPCPYY+SR+LHKVVDILF PYNYLIDR R SL++ W +SVLIFDEAHNLE ICAD Sbjct: 193 RRFGPCPYYVSRELHKVVDILFAPYNYLIDRDYRRSLNLEWHNSVLIFDEAHNLEGICAD 252 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRKAIEKSNE 2 AASFDL SGLLTAC+SEAK CVDL++ R+ E+SN+ Sbjct: 253 AASFDLSSGLLTACISEAKNCVDLAVARR--EESND 286 >ref|XP_007024116.1| Regulator of telomere elongation helicase 1 rtel1, putative isoform 1 [Theobroma cacao] gi|508779482|gb|EOY26738.1| Regulator of telomere elongation helicase 1 rtel1, putative isoform 1 [Theobroma cacao] Length = 1052 Score = 147 bits (371), Expect = 1e-33 Identities = 71/96 (73%), Positives = 82/96 (85%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 R GPCPYY+SR+LHKVVDILF PYNYLIDR R SL++ W +SVLIFDEAHNLE ICAD Sbjct: 193 RRFGPCPYYVSRELHKVVDILFAPYNYLIDRDYRRSLNLEWHNSVLIFDEAHNLEGICAD 252 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRKAIEKSNE 2 AASFDL SGLLTAC+SEAK CVDL++ R+ E+SN+ Sbjct: 253 AASFDLSSGLLTACISEAKNCVDLAVARR--EESND 286 >ref|XP_006595137.1| PREDICTED: regulator of telomere elongation helicase 1-like isoform X1 [Glycine max] Length = 998 Score = 147 bits (370), Expect = 2e-33 Identities = 69/96 (71%), Positives = 83/96 (86%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 R GPCPYYLS++LHK VDI+F PYNYLIDR R+SL + W +S+LIFDEAHNLESICAD Sbjct: 193 RRFGPCPYYLSKELHKFVDIVFAPYNYLIDRGYRKSLQLSWSNSILIFDEAHNLESICAD 252 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRKAIEKSNE 2 AASFDLPS LLTAC+SEA+ C+DLSI+R+ +KSN+ Sbjct: 253 AASFDLPSWLLTACISEAESCIDLSIERR--DKSND 286 >ref|XP_004171721.1| PREDICTED: regulator of telomere elongation helicase 1-like, partial [Cucumis sativus] Length = 695 Score = 147 bits (370), Expect = 2e-33 Identities = 70/93 (75%), Positives = 82/93 (88%) Frame = -3 Query: 280 GPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICADAAS 101 GPCPYY+SR+LHK VDI+F PYNYLIDR R+SL + WK+SVLIFDEAHNLESICADAAS Sbjct: 196 GPCPYYVSRELHKAVDIMFAPYNYLIDRGYRKSLVLEWKNSVLIFDEAHNLESICADAAS 255 Query: 100 FDLPSGLLTACVSEAKKCVDLSIKRKAIEKSNE 2 FDL S LLTAC+SEAK C+DLSIKR+ ++SN+ Sbjct: 256 FDLTSWLLTACISEAKNCIDLSIKRR--DESND 286 >ref|XP_004141849.1| PREDICTED: regulator of telomere elongation helicase 1-like [Cucumis sativus] Length = 1054 Score = 147 bits (370), Expect = 2e-33 Identities = 70/93 (75%), Positives = 82/93 (88%) Frame = -3 Query: 280 GPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICADAAS 101 GPCPYY+SR+LHK VDI+F PYNYLIDR R+SL + WK+SVLIFDEAHNLESICADAAS Sbjct: 196 GPCPYYVSRELHKAVDIMFAPYNYLIDRGYRKSLVLEWKNSVLIFDEAHNLESICADAAS 255 Query: 100 FDLPSGLLTACVSEAKKCVDLSIKRKAIEKSNE 2 FDL S LLTAC+SEAK C+DLSIKR+ ++SN+ Sbjct: 256 FDLTSWLLTACISEAKNCIDLSIKRR--DESND 286 >ref|XP_002528200.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] gi|223532412|gb|EEF34207.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] Length = 1049 Score = 146 bits (368), Expect = 3e-33 Identities = 69/96 (71%), Positives = 81/96 (84%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 R GPCPYY+SR+LHKVVDILF PYNYLIDR R+SL + W S+LIFDEAHNLES+CAD Sbjct: 194 RRFGPCPYYVSRELHKVVDILFAPYNYLIDRSYRKSLKIDWDKSILIFDEAHNLESLCAD 253 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRKAIEKSNE 2 AASFDL SGLLTAC+SEAK C++LS+ R+ E SN+ Sbjct: 254 AASFDLSSGLLTACISEAKSCIELSVARR--EDSND 287 >gb|EXB74483.1| Regulator of telomere elongation helicase 1 [Morus notabilis] Length = 468 Score = 145 bits (367), Expect = 4e-33 Identities = 67/97 (69%), Positives = 86/97 (88%), Gaps = 2/97 (2%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 +++GPCPYY+SR++HKVVDILF PYNYLIDR R+SL++ +K+S+LIFDEAHNLES+CAD Sbjct: 197 KSSGPCPYYMSREIHKVVDILFAPYNYLIDRGYRKSLNLNFKNSILIFDEAHNLESLCAD 256 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRKAI--EKSN 5 AASFDLP LLTAC+SEAK C+D+S+ R+ I +KSN Sbjct: 257 AASFDLPYWLLTACISEAKNCIDISVTRREISDDKSN 293 >ref|XP_004486727.1| PREDICTED: regulator of telomere elongation helicase 1-like isoform X2 [Cicer arietinum] Length = 1009 Score = 145 bits (366), Expect = 6e-33 Identities = 69/96 (71%), Positives = 82/96 (85%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 R +GPCPYYLS++L+KVVDI+F PYNYLIDR R+SL + W +SVLIFDEAHNLE ICAD Sbjct: 197 RASGPCPYYLSKELYKVVDIIFAPYNYLIDRGYRDSLQLSWSNSVLIFDEAHNLEGICAD 256 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRKAIEKSNE 2 AASFDLPS LLTAC+SEA+ CVDL I+R+ KSN+ Sbjct: 257 AASFDLPSWLLTACISEAQNCVDLLIERR--NKSND 290 >ref|XP_004486726.1| PREDICTED: regulator of telomere elongation helicase 1-like isoform X1 [Cicer arietinum] Length = 1006 Score = 145 bits (366), Expect = 6e-33 Identities = 69/96 (71%), Positives = 82/96 (85%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 R +GPCPYYLS++L+KVVDI+F PYNYLIDR R+SL + W +SVLIFDEAHNLE ICAD Sbjct: 197 RASGPCPYYLSKELYKVVDIIFAPYNYLIDRGYRDSLQLSWSNSVLIFDEAHNLEGICAD 256 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRKAIEKSNE 2 AASFDLPS LLTAC+SEA+ CVDL I+R+ KSN+ Sbjct: 257 AASFDLPSWLLTACISEAQNCVDLLIERR--NKSND 290 >ref|XP_007150664.1| hypothetical protein PHAVU_005G171300g [Phaseolus vulgaris] gi|561023928|gb|ESW22658.1| hypothetical protein PHAVU_005G171300g [Phaseolus vulgaris] Length = 971 Score = 145 bits (365), Expect = 7e-33 Identities = 69/96 (71%), Positives = 80/96 (83%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 R GPCPYYLS++LHK VDILF PYNYLIDR R SL + W +SVLIFDEAHNLESICAD Sbjct: 193 RKFGPCPYYLSKELHKFVDILFAPYNYLIDRGYRNSLQLSWSNSVLIFDEAHNLESICAD 252 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRKAIEKSNE 2 AASFDLPS LLT C+ EA+ C+DLSI+R+ +KSN+ Sbjct: 253 AASFDLPSWLLTTCIKEAESCIDLSIERR--DKSND 286 >ref|XP_003597782.1| Regulator of telomere elongation helicase [Medicago truncatula] gi|355486830|gb|AES68033.1| Regulator of telomere elongation helicase [Medicago truncatula] Length = 1089 Score = 145 bits (365), Expect = 7e-33 Identities = 66/96 (68%), Positives = 83/96 (86%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 +T+GPCPY+L+++LHK VDI+F PYNYLIDR R++L + W +S+LIFDEAHNLESICAD Sbjct: 236 KTSGPCPYHLAKELHKAVDIIFAPYNYLIDRGKRKALQISWSNSILIFDEAHNLESICAD 295 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRKAIEKSNE 2 AASFDLPS LLTAC+SEA+ CVDL I+R+ KSN+ Sbjct: 296 AASFDLPSWLLTACISEAQSCVDLLIERR--NKSND 329 >ref|XP_003597775.1| Regulator of telomere elongation helicase [Medicago truncatula] gi|355486823|gb|AES68026.1| Regulator of telomere elongation helicase [Medicago truncatula] Length = 1048 Score = 145 bits (365), Expect = 7e-33 Identities = 66/96 (68%), Positives = 83/96 (86%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 +T+GPCPY+L+++LHK VDI+F PYNYLIDR R++L + W +S+LIFDEAHNLESICAD Sbjct: 195 KTSGPCPYHLAKELHKAVDIIFAPYNYLIDRGKRKALQISWSNSILIFDEAHNLESICAD 254 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRKAIEKSNE 2 AASFDLPS LLTAC+SEA+ CVDL I+R+ KSN+ Sbjct: 255 AASFDLPSWLLTACISEAQSCVDLLIERR--NKSND 288 >gb|EPS57615.1| hypothetical protein M569_17202, partial [Genlisea aurea] Length = 382 Score = 140 bits (354), Expect = 1e-31 Identities = 62/89 (69%), Positives = 79/89 (88%) Frame = -3 Query: 289 RTNGPCPYYLSRDLHKVVDILFTPYNYLIDRRNRESLSVLWKDSVLIFDEAHNLESICAD 110 R +GPCPYYLSR+LHK DI+F+PYNYLIDR R++L +W++S+LIFDEAHNLES+CAD Sbjct: 159 RNSGPCPYYLSRELHKDADIIFSPYNYLIDRDYRKTLKDVWRNSILIFDEAHNLESLCAD 218 Query: 109 AASFDLPSGLLTACVSEAKKCVDLSIKRK 23 AASFDLPS LL +C++EAKKCV+LS+ R+ Sbjct: 219 AASFDLPSILLNSCIAEAKKCVNLSVSRR 247