BLASTX nr result
ID: Cocculus23_contig00037032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00037032 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007019337.1| Myb domain protein 52 [Theobroma cacao] gi|5... 59 7e-07 >ref|XP_007019337.1| Myb domain protein 52 [Theobroma cacao] gi|508724665|gb|EOY16562.1| Myb domain protein 52 [Theobroma cacao] Length = 333 Score = 58.9 bits (141), Expect = 7e-07 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 9/72 (12%) Frame = -2 Query: 258 NYKRSVAPPPFGFVD--HSYGSNKVMIKNEMVN-----SKLRNIAV--QQEQGDESIKTK 106 NY+R V P PFG++ +Y SN +++ E+++ KL NI V QQE D+SIK K Sbjct: 261 NYRR-VVPSPFGYLKLGDNYESNNGVMRKELMSVIDNAPKLANIRVSSQQENDDDSIKQK 319 Query: 105 DVPFIDFLGVGI 70 D PFIDFLGVGI Sbjct: 320 DTPFIDFLGVGI 331