BLASTX nr result
ID: Cocculus23_contig00036208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00036208 (201 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003531870.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g... 60 2e-07 ref|XP_004491975.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g... 55 8e-06 >ref|XP_003531870.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 1-like [Glycine max] Length = 469 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/66 (43%), Positives = 39/66 (59%) Frame = -2 Query: 200 ADLMNVKVIEQSQIAPPQGXXXXXXXXXXXXFDVIWLVPPPVKRLMFFEFRHSKQHFIHT 21 AD + VKVIEQ ++ PP G D+ WL PP+KR+ FF F +S QHF+ T Sbjct: 2 ADTVTVKVIEQCEVGPPPGTVPSTSIPLTFY-DLPWLCCPPLKRIFFFNFPYSSQHFLQT 60 Query: 20 VLPQIK 3 +LP +K Sbjct: 61 LLPSLK 66 >ref|XP_004491975.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 1-like [Cicer arietinum] Length = 512 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/60 (40%), Positives = 33/60 (55%) Frame = -2 Query: 182 KVIEQSQIAPPQGXXXXXXXXXXXXFDVIWLVPPPVKRLMFFEFRHSKQHFIHTVLPQIK 3 +VIEQS+IAPP G D+ W PP++R+ F+ F H HF+ T LP +K Sbjct: 14 RVIEQSEIAPPPGSVPSPTTLPLTFLDIGWFFCPPIQRIFFYHFPHPTHHFLQTTLPILK 73