BLASTX nr result
ID: Cocculus23_contig00035303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00035303 (231 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME80501.1| hypothetical protein MYCFIDRAFT_54532 [Pseudocerc... 50 6e-07 >gb|EME80501.1| hypothetical protein MYCFIDRAFT_54532 [Pseudocercospora fijiensis CIRAD86] Length = 181 Score = 50.1 bits (118), Expect(2) = 6e-07 Identities = 25/42 (59%), Positives = 28/42 (66%) Frame = +2 Query: 104 EPHSKVIIPRHQVMLACLRRVGRSKDRLNAADKSDCKRFPFN 229 E HS +I R Q M+A RRV RS+DR N A KS C RFPFN Sbjct: 43 ELHSSGLIQRSQTMMASRRRVNRSEDRPNTAAKSGCGRFPFN 84 Score = 28.9 bits (63), Expect(2) = 6e-07 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 1 RVSRRAVYNHYASILANA 54 RVSRRA NHYA ILA A Sbjct: 7 RVSRRAADNHYAIILAEA 24