BLASTX nr result
ID: Cocculus23_contig00035236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00035236 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF08155.1| hypothetical protein SEPMUDRAFT_152424 [Sphaeruli... 84 2e-14 gb|EME38783.1| hypothetical protein DOTSEDRAFT_75504 [Dothistrom... 75 7e-12 ref|XP_003847553.1| hypothetical protein MYCGRDRAFT_106475 [Zymo... 74 2e-11 gb|EME87049.1| hypothetical protein MYCFIDRAFT_29423 [Pseudocerc... 72 1e-10 ref|XP_001791011.1| hypothetical protein SNOG_00321 [Phaeosphaer... 69 5e-10 ref|XP_006968637.1| predicted protein [Trichoderma reesei QM6a] ... 68 1e-09 gb|EMD65381.1| hypothetical protein COCSADRAFT_35440 [Bipolaris ... 67 2e-09 gb|ELR07131.1| hypothetical protein GMDG_02400 [Pseudogymnoascus... 67 2e-09 ref|XP_007297747.1| ATP synthase subunit J [Marssonina brunnea f... 67 2e-09 gb|EYE98154.1| putative mitochondrial F1F0 ATP synthase subunit ... 66 4e-09 gb|EMD90057.1| hypothetical protein COCHEDRAFT_1022156 [Bipolari... 66 4e-09 ref|XP_003437504.1| unnamed protein product [Podospora anserina ... 66 4e-09 tpe|CBF77150.1| TPA: mitochondrial F1F0 ATP synthase subunit Atp... 66 6e-09 gb|EOA85637.1| hypothetical protein SETTUDRAFT_169657 [Setosphae... 65 1e-08 gb|EFY91770.1| mitochondrial F1F0 ATP synthase subunit Atp18, pu... 65 1e-08 emb|CCD48968.1| similar to mitochondrial F1F0 ATP synthase subun... 64 2e-08 gb|ACG26238.1| hypothetical protein [Zea mays] 64 2e-08 ref|XP_001560489.1| predicted protein [Botryotinia fuckeliana B0... 64 2e-08 ref|XP_003300651.1| hypothetical protein PTT_11955 [Pyrenophora ... 64 2e-08 ref|XP_002838066.1| hypothetical protein [Tuber melanosporum Mel... 64 2e-08 >gb|EMF08155.1| hypothetical protein SEPMUDRAFT_152424 [Sphaerulina musiva SO2202] Length = 60 Score = 84.3 bits (207), Expect = 2e-14 Identities = 36/51 (70%), Positives = 43/51 (84%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSVNAPKK 163 KFPTPV MWPFY+AGLIIAYGV++ Q+ ++NTDEY+NDPRNPS N KK Sbjct: 8 KFPTPVAKPMWPFYAAGLIIAYGVNSFQTVLANTDEYKNDPRNPSKNIVKK 58 >gb|EME38783.1| hypothetical protein DOTSEDRAFT_75504 [Dothistroma septosporum NZE10] Length = 64 Score = 75.5 bits (184), Expect = 7e-12 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPS 181 KFPTPV MWPFY+AGL+IAYG+++ + ++NTDEY+NDPRNP+ Sbjct: 8 KFPTPVARPMWPFYTAGLVIAYGINSFATVLANTDEYKNDPRNPN 52 >ref|XP_003847553.1| hypothetical protein MYCGRDRAFT_106475 [Zymoseptoria tritici IPO323] gi|339467426|gb|EGP82529.1| hypothetical protein MYCGRDRAFT_106475 [Zymoseptoria tritici IPO323] Length = 62 Score = 73.9 bits (180), Expect = 2e-11 Identities = 27/51 (52%), Positives = 40/51 (78%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSVNAPKK 163 KFP + MWPFY+AG+++ YG+S+ + ++NTDEY+NDPRNP++NA K Sbjct: 8 KFPAQIARPMWPFYTAGVVVLYGISSFANVLANTDEYKNDPRNPNINANSK 58 >gb|EME87049.1| hypothetical protein MYCFIDRAFT_29423 [Pseudocercospora fijiensis CIRAD86] Length = 60 Score = 71.6 bits (174), Expect = 1e-10 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSVNAPK 166 KFPTP+ MWPF++A LI+AYG+++ ++N+DEY+NDPRNP PK Sbjct: 8 KFPTPIAKPMWPFFAATLIVAYGINSFADVLANSDEYKNDPRNPKNKIPK 57 >ref|XP_001791011.1| hypothetical protein SNOG_00321 [Phaeosphaeria nodorum SN15] gi|111070696|gb|EAT91816.1| hypothetical protein SNOG_00321 [Phaeosphaeria nodorum SN15] Length = 60 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSV 178 KFP PV MWPFY +GL+I YGV++ +AM+ DEY+NDPRNP+V Sbjct: 8 KFPAPVARPMWPFYISGLVILYGVNSAANAMATADEYKNDPRNPAV 53 >ref|XP_006968637.1| predicted protein [Trichoderma reesei QM6a] gi|340515192|gb|EGR45448.1| predicted protein [Trichoderma reesei QM6a] Length = 194 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSVNAPKK 163 KFP P WPF++AGL+IAYG ++ Q+AM +DE++NDPRNPSV A K Sbjct: 142 KFPAPFLKPYWPFFAAGLVIAYGANSAQNAMMASDEWKNDPRNPSVKAGNK 192 >gb|EMD65381.1| hypothetical protein COCSADRAFT_35440 [Bipolaris sorokiniana ND90Pr] gi|576918945|gb|EUC33129.1| hypothetical protein COCCADRAFT_5245 [Bipolaris zeicola 26-R-13] gi|576934371|gb|EUC47886.1| hypothetical protein COCMIDRAFT_34623 [Bipolaris oryzae ATCC 44560] gi|578494236|gb|EUN31624.1| hypothetical protein COCVIDRAFT_87483 [Bipolaris victoriae FI3] Length = 59 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSV 178 KFP + MWPFY +GL+I YGV++ +AMS DEY+NDPRNP+V Sbjct: 7 KFPAQIAKPMWPFYVSGLVILYGVNSAANAMSQADEYKNDPRNPAV 52 >gb|ELR07131.1| hypothetical protein GMDG_02400 [Pseudogymnoascus destructans 20631-21] Length = 62 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/55 (50%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRN---PSVNAPKKH 160 KFP P+ + +WPFY+AG ++ YG+S SAMS +DE++NDPRN V A +KH Sbjct: 8 KFPAPIAAPLWPFYTAGAVVLYGISQAASAMSQSDEFKNDPRNRFVSKVKAAEKH 62 >ref|XP_007297747.1| ATP synthase subunit J [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406858915|gb|EKD11995.1| ATP synthase subunit J [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 60 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/53 (54%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSV-NAPKKH 160 KFP PV TM+PFY+AG+I+ +GV+ Q+AM +DE++NDPRNP+ A +KH Sbjct: 8 KFPVPVAKTMFPFYAAGVIVLFGVNAAQNAMMASDEFKNDPRNPNAGKASEKH 60 >gb|EYE98154.1| putative mitochondrial F1F0 ATP synthase subunit Atp18 [Aspergillus ruber CBS 135680] Length = 56 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/52 (51%), Positives = 40/52 (76%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSVNAPKKH 160 KFP PV M PF++AG+++ YG++++ + +S TDE++NDPRNP NA KKH Sbjct: 7 KFPAPVAKPMAPFFAAGVVVLYGINSLANTLSQTDEFKNDPRNP--NAGKKH 56 >gb|EMD90057.1| hypothetical protein COCHEDRAFT_1022156 [Bipolaris maydis C5] gi|477592659|gb|ENI09729.1| hypothetical protein COCC4DRAFT_29688 [Bipolaris maydis ATCC 48331] Length = 59 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSV 178 KFP + MWPFY +GL+I YGV++ +AMS DEY+NDPRNP++ Sbjct: 7 KFPAQIAKPMWPFYVSGLVILYGVNSAANAMSQADEYKNDPRNPAL 52 >ref|XP_003437504.1| unnamed protein product [Podospora anserina S mat+] gi|170940362|emb|CAP65589.1| unnamed protein product [Podospora anserina S mat+] Length = 60 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/48 (58%), Positives = 39/48 (81%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSVNA 172 KFPTPV M PF++A ++IAYGV++ Q+AM N+DE++NDPRNP+ A Sbjct: 11 KFPTPVLRPMAPFFAAAVVIAYGVNSAQTAMMNSDEFKNDPRNPNAKA 58 >tpe|CBF77150.1| TPA: mitochondrial F1F0 ATP synthase subunit Atp18, putative (AFU_orthologue; AFUA_2G02275) [Aspergillus nidulans FGSC A4] Length = 58 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/50 (52%), Positives = 39/50 (78%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSVNAPK 166 KFPTP+ + PF++AGL+I YG+++ +AM+N+ EY+NDPRNP+ A K Sbjct: 8 KFPTPIAKPLGPFFAAGLVILYGINSASNAMANSAEYKNDPRNPNRQAAK 57 >gb|EOA85637.1| hypothetical protein SETTUDRAFT_169657 [Setosphaeria turcica Et28A] Length = 59 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSV 178 KFP + MWPFY +GL+I YGV++ +AM+ DEY+NDPRNP++ Sbjct: 7 KFPAQIAKPMWPFYVSGLVILYGVNSAANAMAQADEYKNDPRNPAL 52 >gb|EFY91770.1| mitochondrial F1F0 ATP synthase subunit Atp18, putative [Metarhizium acridum CQMa 102] gi|322712919|gb|EFZ04492.1| mitochondrial F1F0 ATP synthase subunit Atp18, putative [Metarhizium anisopliae ARSEF 23] gi|594717386|gb|EXV00285.1| ATP synthase J chain [Metarhizium robertsii] Length = 61 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/44 (59%), Positives = 35/44 (79%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNP 184 KFP P MWPF++AGL+IAYG ++ Q+AM +DE++NDPRNP Sbjct: 11 KFPAPFLKPMWPFFAAGLVIAYGANSAQNAMMASDEWKNDPRNP 54 >emb|CCD48968.1| similar to mitochondrial F1F0 ATP synthase subunit Atp18 [Botryotinia fuckeliana T4] Length = 61 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSVNAPK 166 KFP PV M PF+ AG +I YG+++ AMSN++E++NDPRNP+ PK Sbjct: 7 KFPAPVAKPMAPFFVAGAVIMYGINSAAIAMSNSEEFKNDPRNPNAKTPK 56 >gb|ACG26238.1| hypothetical protein [Zea mays] Length = 58 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/52 (51%), Positives = 39/52 (75%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSVNAPKKH 160 KFP + M PF++AGLI+ YGV+++Q+A+SNT E++NDPRNP+ A H Sbjct: 7 KFPGLLAGPMTPFFAAGLIVLYGVNSLQNALSNTAEFKNDPRNPNAKAGNGH 58 >ref|XP_001560489.1| predicted protein [Botryotinia fuckeliana B05.10] Length = 61 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSVNAPK 166 KFP PV M PF+ AG +I YG+++ AMSN++E++NDPRNP+ PK Sbjct: 7 KFPAPVAKPMAPFFVAGAVIMYGINSAAIAMSNSEEFKNDPRNPNAKTPK 56 >ref|XP_003300651.1| hypothetical protein PTT_11955 [Pyrenophora teres f. teres 0-1] gi|311325115|gb|EFQ91258.1| hypothetical protein PTT_11955 [Pyrenophora teres f. teres 0-1] Length = 91 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSV 178 KFP + MWPFY +GL+I YGV++ +AM+ +EY+NDPRNP+V Sbjct: 39 KFPAQIAKPMWPFYVSGLVILYGVNSAANAMAQGEEYKNDPRNPAV 84 >ref|XP_002838066.1| hypothetical protein [Tuber melanosporum Mel28] gi|295633966|emb|CAZ82257.1| unnamed protein product [Tuber melanosporum] Length = 66 Score = 63.9 bits (154), Expect = 2e-08 Identities = 24/48 (50%), Positives = 38/48 (79%) Frame = -2 Query: 315 KFPTPVGSTMWPFYSAGLIIAYGVSTIQSAMSNTDEYRNDPRNPSVNA 172 K+PTP+ M PFY AG+++ YGV+++ + ++NT+EY+NDPRNP+ A Sbjct: 9 KWPTPIAKPMAPFYIAGVVVFYGVNSLSNFLANTEEYKNDPRNPNARA 56