BLASTX nr result
ID: Cocculus23_contig00034433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00034433 (488 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006380825.1| hypothetical protein POPTR_0007s14760g [Popu... 59 9e-07 >ref|XP_006380825.1| hypothetical protein POPTR_0007s14760g [Populus trichocarpa] gi|550334902|gb|ERP58622.1| hypothetical protein POPTR_0007s14760g [Populus trichocarpa] Length = 54 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/54 (55%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 111 MFWRSRFLSLPMXXXXXXXXXXXXXXXFGPPLEEYWSKKLQEE-VAKETDTGST 269 MF+RSRFLS P+ FGPPL+EYW KKL EE AKETDT ST Sbjct: 1 MFFRSRFLSFPLVIGAVIIGVVSGKAIFGPPLDEYWKKKLDEEAAAKETDTSST 54