BLASTX nr result
ID: Cocculus23_contig00034386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00034386 (201 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN60188.1| hypothetical protein VITISV_002117 [Vitis vinifera] 57 3e-06 >emb|CAN60188.1| hypothetical protein VITISV_002117 [Vitis vinifera] Length = 1079 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/63 (41%), Positives = 34/63 (53%) Frame = -2 Query: 191 KCWFRFDSNFHGPSANSGNDSVVNGASAPSAQTTSTVSPPTAAFLATPETICDTSWYPDS 12 +C++R+D +F GP S +P Q P +ATPE ICDT+WYPDS Sbjct: 294 RCYYRYDPSFQGPHTPGFTPSF---QKSPQTQIQGGNKPNMQVLMATPENICDTNWYPDS 350 Query: 11 GAS 3 GAS Sbjct: 351 GAS 353