BLASTX nr result
ID: Cocculus23_contig00034175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00034175 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006385031.1| hypothetical protein POPTR_0004s23230g [Popu... 60 4e-07 >ref|XP_006385031.1| hypothetical protein POPTR_0004s23230g [Populus trichocarpa] gi|550341799|gb|ERP62828.1| hypothetical protein POPTR_0004s23230g [Populus trichocarpa] Length = 876 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/48 (52%), Positives = 33/48 (68%) Frame = -1 Query: 149 LAH*WKNWKTHLKADYFTPYVDDEIRLNTIPRRVLGEQWEVLLKYWKS 6 LA W+NWK LK++++ P+ DE RLN RRVL EQW +L+ YW S Sbjct: 631 LASKWRNWKAKLKSEHYYPHKTDEERLNDRDRRVLPEQWAILISYWNS 678