BLASTX nr result
ID: Cocculus23_contig00033904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00033904 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006360680.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_004240287.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_007208178.1| hypothetical protein PRUPE_ppa017277mg, part... 57 3e-06 >ref|XP_006360680.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like [Solanum tuberosum] Length = 723 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = +3 Query: 234 QLLTLNSSIAKFNRSHQFSRALQLFNEIHSSQHLKPDHYTYATART 371 QL+ LN ++ F SHQFS AL LFN+IHSS HL+PDHYT +T T Sbjct: 10 QLIKLNCLLSNFTHSHQFSDALSLFNQIHSSLHLRPDHYTLSTTLT 55 >ref|XP_004240287.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like [Solanum lycopersicum] Length = 720 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +3 Query: 246 LNSSIAKFNRSHQFSRALQLFNEIHSSQHLKPDHYTYATARTNS 377 LNS ++ F SHQFS AL LFN+IHSS HL+PDHYT +T T S Sbjct: 11 LNSLLSNFTHSHQFSDALSLFNQIHSSLHLRPDHYTLSTTLTAS 54 >ref|XP_007208178.1| hypothetical protein PRUPE_ppa017277mg, partial [Prunus persica] gi|462403820|gb|EMJ09377.1| hypothetical protein PRUPE_ppa017277mg, partial [Prunus persica] Length = 634 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = +3 Query: 234 QLLTLNSSIAKFNRSHQFSRALQLFNEIHSSQHLKPDHYTYATART 371 Q+L LN S+AK RSH +S ALQLF +I SSQ ++PDHYT + A T Sbjct: 20 QILKLNQSLAKLTRSHCYSEALQLFTQILSSQSVRPDHYTLSAAVT 65