BLASTX nr result
ID: Cocculus23_contig00033867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00033867 (716 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON69120.1| hypothetical protein W97_08306 [Coniosporium apol... 59 2e-06 ref|XP_007580233.1| putative glycine-rich cell wall structural p... 57 8e-06 gb|EME47544.1| hypothetical protein DOTSEDRAFT_69482 [Dothistrom... 57 8e-06 >gb|EON69120.1| hypothetical protein W97_08306 [Coniosporium apollinis CBS 100218] Length = 534 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/55 (50%), Positives = 37/55 (67%) Frame = -2 Query: 664 DSIMDKVNEVIGAGKTVGQSGQEPVSGVQGKGTAGEPFDQGNNQEDASKRGEAAQ 500 +S+ + ++G+G T QSGQEPVSG G GT EP+DQGN +D +K G AAQ Sbjct: 2 ESVKQTASNLMGSGNTT-QSGQEPVSGQTGAGTVNEPYDQGNQYDDPAKGGAAAQ 55 >ref|XP_007580233.1| putative glycine-rich cell wall structural protein 1 protein [Neofusicoccum parvum UCRNP2] gi|485928599|gb|EOD52284.1| putative glycine-rich cell wall structural protein 1 protein [Neofusicoccum parvum UCRNP2] Length = 320 Score = 56.6 bits (135), Expect = 8e-06 Identities = 35/104 (33%), Positives = 50/104 (48%) Frame = -2 Query: 661 SIMDKVNEVIGAGKTVGQSGQEPVSGVQGKGTAGEPFDQGNNQEDASKRGEAAQNVGTST 482 +I +++I QSGQEPVSG G+GTA EP+D GN + + G++AQ T T Sbjct: 6 NIATSASKLIYGDPKAEQSGQEPVSGQTGRGTAEEPYDSGNLEGNPELGGKSAQETRTDT 65 Query: 481 SETVKNLAGSAKQAGSGANDQ*ALRQEELSAGAANSR*GGYLRP 350 S + A + GS A A ++ GG +RP Sbjct: 66 SVPTSSAASNPLSGGSAATT------------ATSAAQGGAIRP 97 >gb|EME47544.1| hypothetical protein DOTSEDRAFT_69482 [Dothistroma septosporum NZE10] Length = 436 Score = 56.6 bits (135), Expect = 8e-06 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = -2 Query: 655 MDKVNEVIGAGKTVGQSGQEPVSGVQGKGTAGEPFDQGNNQEDASKRGEAAQN 497 MD + +VI G +SGQEPVSG QG+GTA P+DQGN +++A G+ AQN Sbjct: 1 MDTLKKVI-MGDPKAESGQEPVSGSQGQGTADAPYDQGNQEDNADLAGKPAQN 52