BLASTX nr result
ID: Cocculus23_contig00033810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00033810 (460 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME47825.1| hypothetical protein DOTSEDRAFT_69679 [Dothistrom... 72 8e-11 gb|EMC92408.1| hypothetical protein BAUCODRAFT_38462 [Baudoinia ... 64 2e-08 >gb|EME47825.1| hypothetical protein DOTSEDRAFT_69679 [Dothistroma septosporum NZE10] Length = 866 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = -2 Query: 141 GSATGGNPYSGYIHQTHGPHPTDIGNRLDPHIPGEFPSEGGEDRH 7 G G P GY+H T GPH TD NRLDPH+PGEFP+E G+DRH Sbjct: 326 GDNCDGRPAEGYVHHTQGPHSTDTANRLDPHVPGEFPTESGQDRH 370 >gb|EMC92408.1| hypothetical protein BAUCODRAFT_38462 [Baudoinia compniacensis UAMH 10762] Length = 512 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -2 Query: 120 PYSGYIHQTHGPHPTDIGNRLDPHIPGEFPSEGGEDRHR 4 P GY H GPH TDI N LDPH+PGE+P+E GEDRH+ Sbjct: 58 PVEGYYHHVPGPHATDIANVLDPHVPGEYPTEDGEDRHK 96