BLASTX nr result
ID: Cocculus23_contig00033788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00033788 (592 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007013929.1| Eukaryotic aspartyl protease family protein,... 58 2e-06 >ref|XP_007013929.1| Eukaryotic aspartyl protease family protein, putative [Theobroma cacao] gi|508784292|gb|EOY31548.1| Eukaryotic aspartyl protease family protein, putative [Theobroma cacao] Length = 454 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 8/87 (9%) Frame = -2 Query: 570 CYFGTL--DYLEFKGVTFHLAYGLDVTQYKTNLFMKVNEFMCCFAVWPTALGGS-----S 412 CY GT+ D + F VTFH A G D+ +LF+++ + C AV P+ GG S Sbjct: 362 CYMGTISQDLVGFPAVTFHFARGADLVLDTESLFVQIQPYAFCMAVLPSYAGGDNITTLS 421 Query: 411 VLGNLFQQ-YSVAYDLDIKLVSFTRTE 334 ++G L QQ Y++AYD+ K +SF R + Sbjct: 422 LIGLLAQQNYNIAYDIYGKALSFQRID 448