BLASTX nr result
ID: Cocculus23_contig00033787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00033787 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006852426.1| hypothetical protein AMTR_s00021p00070600 [A... 61 2e-07 >ref|XP_006852426.1| hypothetical protein AMTR_s00021p00070600 [Amborella trichopoda] gi|548856037|gb|ERN13893.1| hypothetical protein AMTR_s00021p00070600 [Amborella trichopoda] Length = 394 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = +2 Query: 2 FGRLHDLMRRQIVERVPLQGGP---QSPSTPYKFLPNSDEMKDLSSFVINPSGTE 157 FGRLHD++R+QI+ERVP QG P + TPY FLP +EM+DLSSF + P E Sbjct: 331 FGRLHDILRKQIIERVPHQGVPSIRDTTKTPY-FLPKREEMRDLSSFAMPPQKEE 384