BLASTX nr result
ID: Cocculus23_contig00033329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00033329 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON61620.1| ATP synthase subunit beta, mitochondrial [Coniosp... 60 4e-07 gb|EHY54877.1| ATP synthase subunit beta, mitochondrial [Exophia... 58 1e-06 dbj|BAK06030.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 2e-06 gb|EKG11188.1| hypothetical protein MPH_11659 [Macrophomina phas... 57 2e-06 gb|ADG23107.1| ATP synthase F1 beta subunit [Rhizoplaca chrysole... 57 2e-06 gb|EMC96166.1| hypothetical protein BAUCODRAFT_33509 [Baudoinia ... 57 3e-06 gb|EXJ93704.1| ATP synthase subunit beta, mitochondrial [Caproni... 57 3e-06 gb|EXJ69673.1| ATP synthase subunit beta, mitochondrial [Cladoph... 57 3e-06 gb|ETI24137.1| ATP synthase subunit beta, mitochondrial [Cladoph... 57 3e-06 ref|XP_003302169.1| hypothetical protein PTT_13892 [Pyrenophora ... 57 3e-06 ref|XP_001934035.1| ATP synthase subunit beta [Pyrenophora triti... 57 3e-06 ref|XP_007581512.1| putative -alpha-glucan-branching enzyme prot... 56 5e-06 gb|EUN32260.1| hypothetical protein COCVIDRAFT_33118 [Bipolaris ... 56 6e-06 gb|EUC49005.1| hypothetical protein COCMIDRAFT_2258 [Bipolaris o... 56 6e-06 gb|EUC38510.1| hypothetical protein COCCADRAFT_32438 [Bipolaris ... 56 6e-06 gb|EOA88366.1| hypothetical protein SETTUDRAFT_27183 [Setosphaer... 56 6e-06 gb|EMD87483.1| hypothetical protein COCHEDRAFT_1145179 [Bipolari... 56 6e-06 gb|EMD59290.1| hypothetical protein COCSADRAFT_41155 [Bipolaris ... 56 6e-06 gb|ELR08810.1| ATP synthase subunit beta, mitochondrial [Pseudog... 56 6e-06 gb|EHL00574.1| putative ATP synthase subunit beta, mitochondrial... 56 6e-06 >gb|EON61620.1| ATP synthase subunit beta, mitochondrial [Coniosporium apollinis CBS 100218] Length = 518 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGDIESARAKGEKILADLEKS Sbjct: 490 LPEGAFYMVGDIESARAKGEKILADLEKS 518 >gb|EHY54877.1| ATP synthase subunit beta, mitochondrial [Exophiala dermatitidis NIH/UT8656] Length = 519 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKSS 190 LPEGAFYMVGD ESARAKGEKILA+LEKSS Sbjct: 490 LPEGAFYMVGDFESARAKGEKILAELEKSS 519 >dbj|BAK06030.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 517 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGD+ESARAKGEKILADLEK+ Sbjct: 489 LPEGAFYMVGDLESARAKGEKILADLEKN 517 >gb|EKG11188.1| hypothetical protein MPH_11659 [Macrophomina phaseolina MS6] Length = 517 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGD+ESARAKGEKILA+LEKS Sbjct: 489 LPEGAFYMVGDLESARAKGEKILAELEKS 517 >gb|ADG23107.1| ATP synthase F1 beta subunit [Rhizoplaca chrysoleuca] Length = 160 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGDI+SARAKGEKILADLEK+ Sbjct: 132 LPEGAFYMVGDIDSARAKGEKILADLEKN 160 >gb|EMC96166.1| hypothetical protein BAUCODRAFT_33509 [Baudoinia compniacensis UAMH 10762] Length = 511 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGD+ESAR KGEKILADLEKS Sbjct: 483 LPEGAFYMVGDLESARQKGEKILADLEKS 511 >gb|EXJ93704.1| ATP synthase subunit beta, mitochondrial [Capronia coronata CBS 617.96] Length = 518 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGD ESARAKGEKILA+LEKS Sbjct: 490 LPEGAFYMVGDFESARAKGEKILAELEKS 518 >gb|EXJ69673.1| ATP synthase subunit beta, mitochondrial [Cladophialophora psammophila CBS 110553] Length = 518 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGD ESARAKGEKILA+LEKS Sbjct: 490 LPEGAFYMVGDFESARAKGEKILAELEKS 518 >gb|ETI24137.1| ATP synthase subunit beta, mitochondrial [Cladophialophora carrionii CBS 160.54] Length = 518 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGD ESARAKGEKILA+LEKS Sbjct: 490 LPEGAFYMVGDFESARAKGEKILAELEKS 518 >ref|XP_003302169.1| hypothetical protein PTT_13892 [Pyrenophora teres f. teres 0-1] gi|311322642|gb|EFQ89755.1| hypothetical protein PTT_13892 [Pyrenophora teres f. teres 0-1] Length = 517 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGD ESARAKGEKILA+LEKS Sbjct: 489 LPEGAFYMVGDFESARAKGEKILAELEKS 517 >ref|XP_001934035.1| ATP synthase subunit beta [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979914|gb|EDU46540.1| ATP synthase subunit beta [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 498 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGD ESARAKGEKILA+LEKS Sbjct: 470 LPEGAFYMVGDFESARAKGEKILAELEKS 498 >ref|XP_007581512.1| putative -alpha-glucan-branching enzyme protein [Neofusicoccum parvum UCRNP2] gi|485926819|gb|EOD51011.1| putative -alpha-glucan-branching enzyme protein [Neofusicoccum parvum UCRNP2] Length = 1222 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGD+ESAR+KGEKILA+LEKS Sbjct: 1194 LPEGAFYMVGDLESARSKGEKILAELEKS 1222 >gb|EUN32260.1| hypothetical protein COCVIDRAFT_33118 [Bipolaris victoriae FI3] Length = 503 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGD SARAKGEKILADLEKS Sbjct: 475 LPEGAFYMVGDFASARAKGEKILADLEKS 503 >gb|EUC49005.1| hypothetical protein COCMIDRAFT_2258 [Bipolaris oryzae ATCC 44560] Length = 514 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGD SARAKGEKILADLEKS Sbjct: 486 LPEGAFYMVGDFASARAKGEKILADLEKS 514 >gb|EUC38510.1| hypothetical protein COCCADRAFT_32438 [Bipolaris zeicola 26-R-13] Length = 516 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGD SARAKGEKILADLEKS Sbjct: 488 LPEGAFYMVGDFASARAKGEKILADLEKS 516 >gb|EOA88366.1| hypothetical protein SETTUDRAFT_27183 [Setosphaeria turcica Et28A] Length = 553 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGD SARAKGEKILADLEKS Sbjct: 525 LPEGAFYMVGDFASARAKGEKILADLEKS 553 >gb|EMD87483.1| hypothetical protein COCHEDRAFT_1145179 [Bipolaris maydis C5] gi|477589606|gb|ENI06682.1| hypothetical protein COCC4DRAFT_192700 [Bipolaris maydis ATCC 48331] Length = 516 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGD SARAKGEKILADLEKS Sbjct: 488 LPEGAFYMVGDFASARAKGEKILADLEKS 516 >gb|EMD59290.1| hypothetical protein COCSADRAFT_41155 [Bipolaris sorokiniana ND90Pr] Length = 516 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPEGAFYMVGD SARAKGEKILADLEKS Sbjct: 488 LPEGAFYMVGDFASARAKGEKILADLEKS 516 >gb|ELR08810.1| ATP synthase subunit beta, mitochondrial [Pseudogymnoascus destructans 20631-21] Length = 516 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEKS 193 LPE AFYMVGD ESARAKGEKILADLEKS Sbjct: 487 LPENAFYMVGDFESARAKGEKILADLEKS 515 >gb|EHL00574.1| putative ATP synthase subunit beta, mitochondrial [Glarea lozoyensis 74030] gi|512198269|gb|EPE27104.1| P-loop containing nucleoside triphosphate hydrolase [Glarea lozoyensis ATCC 20868] Length = 510 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -2 Query: 279 LPEGAFYMVGDIESARAKGEKILADLEK 196 LPEGAFYMVGDI++ARAKGEKILADLEK Sbjct: 482 LPEGAFYMVGDIDAARAKGEKILADLEK 509