BLASTX nr result
ID: Cocculus23_contig00033114
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00033114 (213 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME48691.1| hypothetical protein DOTSEDRAFT_67657 [Dothistrom... 55 8e-06 >gb|EME48691.1| hypothetical protein DOTSEDRAFT_67657 [Dothistroma septosporum NZE10] Length = 288 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = +3 Query: 3 TGYTGTTNAGSAINNDKYETAPAGTHTGYYTQPTGTGANPYGYE 134 TG TG+T G+ DK PAG HTGYYTQP G G NPYGY+ Sbjct: 236 TGLTGST-VGNTGTFDKTVHEPAGAHTGYYTQPQGAGVNPYGYD 278