BLASTX nr result
ID: Cocculus23_contig00032909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00032909 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC97238.1| hypothetical protein BAUCODRAFT_32985 [Baudoinia ... 55 8e-06 >gb|EMC97238.1| hypothetical protein BAUCODRAFT_32985 [Baudoinia compniacensis UAMH 10762] Length = 173 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/73 (34%), Positives = 39/73 (53%) Frame = -2 Query: 223 DKNIAMYTMRLHEWCQRRNKSLDWDDKHLSFDPPLWEISLKVEGAIFTGKAKNRKQARHI 44 D + YT + E+ R + W D+ +S P LW + V G F G N+K ARH+ Sbjct: 101 DIELPRYTSAIKEYGDRTGIDVQWTDECVSVSPQLWRVWAHVGGTRFFGTGDNKKLARHL 160 Query: 43 ASKKACKELMIDA 5 AS++AC+ ++A Sbjct: 161 ASQQACQRFAVEA 173