BLASTX nr result
ID: Cocculus23_contig00032423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00032423 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007222761.1| hypothetical protein PRUPE_ppa008747mg [Prun... 69 5e-10 gb|EYU32322.1| hypothetical protein MIMGU_mgv1a009317mg [Mimulus... 68 1e-09 ref|XP_004143040.1| PREDICTED: probable ADP,ATP carrier protein ... 67 3e-09 ref|XP_006351576.1| PREDICTED: probable ADP,ATP carrier protein ... 67 3e-09 ref|XP_002279110.1| PREDICTED: probable ADP,ATP carrier protein ... 67 3e-09 ref|XP_006475905.1| PREDICTED: probable ADP,ATP carrier protein ... 66 4e-09 ref|XP_006450862.1| hypothetical protein CICLE_v10008927mg [Citr... 66 4e-09 ref|XP_002309493.1| hypothetical protein POPTR_0006s24360g [Popu... 65 7e-09 ref|XP_007012303.1| Mitochondrial substrate carrier family prote... 65 1e-08 gb|EXB66851.1| putative ADP,ATP carrier protein [Morus notabilis] 65 1e-08 ref|XP_006401316.1| hypothetical protein EUTSA_v10014052mg [Eutr... 65 1e-08 ref|XP_006280789.1| hypothetical protein CARUB_v10026765mg [Caps... 65 1e-08 ref|XP_004245089.1| PREDICTED: probable ADP,ATP carrier protein ... 65 1e-08 ref|XP_002516425.1| ADP,ATP carrier protein, putative [Ricinus c... 65 1e-08 ref|XP_007136831.1| hypothetical protein PHAVU_009G078000g [Phas... 64 2e-08 ref|XP_003527750.1| PREDICTED: probable ADP,ATP carrier protein ... 64 2e-08 ref|XP_003523645.1| PREDICTED: probable ADP,ATP carrier protein ... 64 2e-08 ref|XP_006654718.1| PREDICTED: LOW QUALITY PROTEIN: probable ADP... 64 3e-08 ref|NP_200456.1| probable ADP,ATP carrier protein [Arabidopsis ... 64 3e-08 ref|XP_002866150.1| mitochondrial substrate carrier family prote... 64 3e-08 >ref|XP_007222761.1| hypothetical protein PRUPE_ppa008747mg [Prunus persica] gi|462419697|gb|EMJ23960.1| hypothetical protein PRUPE_ppa008747mg [Prunus persica] Length = 320 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDGL 203 SFYRGAVSNMFRSTGAAAILVLYDE+KKF NW GL Sbjct: 286 SFYRGAVSNMFRSTGAAAILVLYDEVKKFMNWGGL 320 >gb|EYU32322.1| hypothetical protein MIMGU_mgv1a009317mg [Mimulus guttatus] Length = 346 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDGL 203 SFYRGAVSN+FRSTGAAA+LVLYDEIKKF NW GL Sbjct: 312 SFYRGAVSNIFRSTGAAAVLVLYDEIKKFMNWSGL 346 >ref|XP_004143040.1| PREDICTED: probable ADP,ATP carrier protein At5g56450-like [Cucumis sativus] gi|449522752|ref|XP_004168390.1| PREDICTED: probable ADP,ATP carrier protein At5g56450-like [Cucumis sativus] Length = 325 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDGL 203 SFYRGAVSNMFRSTGAAAILVLYDE+KKF W GL Sbjct: 291 SFYRGAVSNMFRSTGAAAILVLYDEVKKFMKWGGL 325 >ref|XP_006351576.1| PREDICTED: probable ADP,ATP carrier protein At5g56450-like [Solanum tuberosum] Length = 321 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDGL 203 SFYRGA+SN+FRSTGAAA+LVLYDE+KKF NW GL Sbjct: 287 SFYRGALSNIFRSTGAAAVLVLYDEVKKFMNWSGL 321 >ref|XP_002279110.1| PREDICTED: probable ADP,ATP carrier protein At5g56450 [Vitis vinifera] gi|296081646|emb|CBI20651.3| unnamed protein product [Vitis vinifera] Length = 323 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDG 206 SFYRGAVSNMFRSTG AAILVLYDE+KKF NW G Sbjct: 289 SFYRGAVSNMFRSTGGAAILVLYDEVKKFMNWSG 322 >ref|XP_006475905.1| PREDICTED: probable ADP,ATP carrier protein At5g56450-like [Citrus sinensis] Length = 321 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDGL 203 SFYRGAVSNMFRSTGAAAILVLYDE+KKF NW L Sbjct: 287 SFYRGAVSNMFRSTGAAAILVLYDEVKKFMNWGRL 321 >ref|XP_006450862.1| hypothetical protein CICLE_v10008927mg [Citrus clementina] gi|557554088|gb|ESR64102.1| hypothetical protein CICLE_v10008927mg [Citrus clementina] Length = 321 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDGL 203 SFYRGAVSNMFRSTGAAAILVLYDE+KKF NW L Sbjct: 287 SFYRGAVSNMFRSTGAAAILVLYDEVKKFMNWGRL 321 >ref|XP_002309493.1| hypothetical protein POPTR_0006s24360g [Populus trichocarpa] gi|222855469|gb|EEE93016.1| hypothetical protein POPTR_0006s24360g [Populus trichocarpa] Length = 327 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDGL 203 SFYRGAVSN+FRSTGAAAILVLYDE+KKF W GL Sbjct: 293 SFYRGAVSNVFRSTGAAAILVLYDEVKKFMKWGGL 327 >ref|XP_007012303.1| Mitochondrial substrate carrier family protein [Theobroma cacao] gi|508782666|gb|EOY29922.1| Mitochondrial substrate carrier family protein [Theobroma cacao] Length = 324 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDGL 203 SFYRGA+SN+FRS+GAAAILVLYDE+KKF NW GL Sbjct: 290 SFYRGALSNVFRSSGAAAILVLYDEVKKFMNWGGL 324 >gb|EXB66851.1| putative ADP,ATP carrier protein [Morus notabilis] Length = 324 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDGL 203 SFYRG VSNMFRSTGAAAILVLYDE+KKF NW L Sbjct: 290 SFYRGTVSNMFRSTGAAAILVLYDEVKKFMNWGRL 324 >ref|XP_006401316.1| hypothetical protein EUTSA_v10014052mg [Eutrema salsugineum] gi|557102406|gb|ESQ42769.1| hypothetical protein EUTSA_v10014052mg [Eutrema salsugineum] Length = 336 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDGL 203 SFYRGA+SNMFRSTG+AAILV YDE+KKF NW G+ Sbjct: 302 SFYRGALSNMFRSTGSAAILVFYDEVKKFLNWGGI 336 >ref|XP_006280789.1| hypothetical protein CARUB_v10026765mg [Capsella rubella] gi|482549493|gb|EOA13687.1| hypothetical protein CARUB_v10026765mg [Capsella rubella] Length = 329 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDGL 203 SFYRGA+SNMFRSTG+AAILV YDE+KKF NW G+ Sbjct: 295 SFYRGALSNMFRSTGSAAILVFYDEVKKFLNWGGI 329 >ref|XP_004245089.1| PREDICTED: probable ADP,ATP carrier protein At5g56450-like [Solanum lycopersicum] Length = 326 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDGL 203 SFYRGA+SN+FRS GAAA+LVLYDE+KKF NW GL Sbjct: 292 SFYRGALSNIFRSAGAAAVLVLYDEVKKFMNWSGL 326 >ref|XP_002516425.1| ADP,ATP carrier protein, putative [Ricinus communis] gi|223544245|gb|EEF45766.1| ADP,ATP carrier protein, putative [Ricinus communis] Length = 326 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDGL 203 SFYRGA+SNMFRS+GAAAILVLYDEIKKF W GL Sbjct: 292 SFYRGALSNMFRSSGAAAILVLYDEIKKFMQWGGL 326 >ref|XP_007136831.1| hypothetical protein PHAVU_009G078000g [Phaseolus vulgaris] gi|561009918|gb|ESW08825.1| hypothetical protein PHAVU_009G078000g [Phaseolus vulgaris] Length = 324 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNW 212 SFYRGAVSN+FRSTGAAAILVLYDE+KKF NW Sbjct: 290 SFYRGAVSNVFRSTGAAAILVLYDEVKKFMNW 321 >ref|XP_003527750.1| PREDICTED: probable ADP,ATP carrier protein At5g56450-like [Glycine max] Length = 321 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNW 212 SFYRGAVSN+FRSTGAAAILVLYDE+KKF NW Sbjct: 287 SFYRGAVSNVFRSTGAAAILVLYDEVKKFMNW 318 >ref|XP_003523645.1| PREDICTED: probable ADP,ATP carrier protein At5g56450-like [Glycine max] Length = 316 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNW 212 SFYRGAVSN+FRSTGAAAILVLYDE+KKF NW Sbjct: 282 SFYRGAVSNVFRSTGAAAILVLYDEVKKFMNW 313 >ref|XP_006654718.1| PREDICTED: LOW QUALITY PROTEIN: probable ADP,ATP carrier protein At5g56450-like [Oryza brachyantha] Length = 401 Score = 63.5 bits (153), Expect = 3e-08 Identities = 37/66 (56%), Positives = 48/66 (72%) Frame = -2 Query: 310 KSFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDGL*QWVQRLVLC*EMQLDQMKKKNTD 131 KSFYRGA+SNMFRSTGAAAILVLYDE+KKF + GL Q +QR M++ Q K K + Sbjct: 294 KSFYRGALSNMFRSTGAAAILVLYDEVKKFMD-RGLVQVLQRF-FGFSMEIRQPKVKISQ 351 Query: 130 RKYRQR 113 + +++ Sbjct: 352 HQXKEK 357 >ref|NP_200456.1| probable ADP,ATP carrier protein [Arabidopsis thaliana] gi|75309203|sp|Q9FM86.1|ADT5_ARATH RecName: Full=Probable ADP,ATP carrier protein At5g56450; AltName: Full=ADP/ATP translocase At5g56450; AltName: Full=Adenine nucleotide translocator At5g56450 gi|10177844|dbj|BAB11273.1| ADP/ATP translocase-like protein [Arabidopsis thaliana] gi|108385397|gb|ABF85782.1| At5g56450 [Arabidopsis thaliana] gi|332009383|gb|AED96766.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator) [Arabidopsis thaliana] Length = 330 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDGL 203 SFYRGA+SNMFRSTG+AAILV YDE+K+F NW G+ Sbjct: 296 SFYRGALSNMFRSTGSAAILVFYDEVKRFLNWGGI 330 >ref|XP_002866150.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] gi|297311985|gb|EFH42409.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] Length = 329 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 307 SFYRGAVSNMFRSTGAAAILVLYDEIKKFFNWDGL 203 SFYRGA+SNMFRSTG+AAILV YDE+K+F NW G+ Sbjct: 295 SFYRGALSNMFRSTGSAAILVFYDEVKRFLNWGGI 329