BLASTX nr result
ID: Cocculus23_contig00032360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00032360 (474 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007220955.1| hypothetical protein PRUPE_ppa024253mg [Prun... 56 6e-06 >ref|XP_007220955.1| hypothetical protein PRUPE_ppa024253mg [Prunus persica] gi|462417417|gb|EMJ22154.1| hypothetical protein PRUPE_ppa024253mg [Prunus persica] Length = 205 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/63 (47%), Positives = 39/63 (61%), Gaps = 5/63 (7%) Frame = -1 Query: 441 KNKLKKGRRDATHSNTDPHAKNKKKRFFSMP-----EQHALPQDFIDKQRAYFAEVDAFE 277 +N L K + D S + +KK+ + P HALPQDFI+KQRAYFAE+DAFE Sbjct: 136 RNILGKLKEDGHSSLSKESTAPRKKKQCAAPAGKAVSMHALPQDFIEKQRAYFAEIDAFE 195 Query: 276 LPD 268 LP+ Sbjct: 196 LPE 198