BLASTX nr result
ID: Cocculus23_contig00032336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00032336 (219 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006343031.1| PREDICTED: pentatricopeptide repeat-containi... 76 5e-12 ref|XP_004236396.1| PREDICTED: pentatricopeptide repeat-containi... 75 9e-12 emb|CBI36037.3| unnamed protein product [Vitis vinifera] 68 1e-09 emb|CAN82028.1| hypothetical protein VITISV_000613 [Vitis vinifera] 68 1e-09 gb|EXB74598.1| hypothetical protein L484_026295 [Morus notabilis] 67 3e-09 ref|XP_004486474.1| PREDICTED: pentatricopeptide repeat-containi... 66 4e-09 ref|XP_007147463.1| hypothetical protein PHAVU_006G126800g [Phas... 66 6e-09 ref|XP_007045547.1| ABA Overly-Sensitive 5 isoform 1 [Theobroma ... 65 1e-08 gb|EYU24069.1| hypothetical protein MIMGU_mgv1a002658mg [Mimulus... 64 2e-08 ref|XP_006597666.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 gb|EPS67014.1| hypothetical protein M569_07760, partial [Genlise... 63 4e-08 ref|XP_004305254.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 ref|XP_007215014.1| hypothetical protein PRUPE_ppa002515mg [Prun... 63 5e-08 ref|XP_003594555.1| Pentatricopeptide repeat-containing protein ... 62 8e-08 ref|XP_006392974.1| hypothetical protein EUTSA_v10011294mg [Eutr... 61 1e-07 ref|XP_004163164.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 ref|XP_004150337.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_006426850.1| hypothetical protein CICLE_v10025103mg [Citr... 59 7e-07 ref|XP_002894344.1| pentatricopeptide repeat-containing protein ... 59 9e-07 ref|NP_683419.1| ABA Overly-Sensitive 5 protein [Arabidopsis tha... 58 2e-06 >ref|XP_006343031.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial-like [Solanum tuberosum] Length = 653 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = +2 Query: 41 RWFATKYSGRVVHSTQSGRSLAIEVHAPTITRDVRGYALPRRDLICKITKIL 196 R FATKYSGRVV + GRS A+EV APT+ D RGYALPRRDLICK+++IL Sbjct: 15 RCFATKYSGRVVVEAEDGRSFAVEVDAPTLHTDSRGYALPRRDLICKVSQIL 66 >ref|XP_004236396.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial-like [Solanum lycopersicum] Length = 663 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/52 (67%), Positives = 42/52 (80%) Frame = +2 Query: 41 RWFATKYSGRVVHSTQSGRSLAIEVHAPTITRDVRGYALPRRDLICKITKIL 196 R+ ATKYSGRVV + GRS A+EV APT+ D RGYALPRRDLICK+++IL Sbjct: 19 RYLATKYSGRVVVEAEDGRSFAVEVDAPTLHTDSRGYALPRRDLICKVSQIL 70 >emb|CBI36037.3| unnamed protein product [Vitis vinifera] Length = 646 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/59 (61%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = +2 Query: 23 FNNITKRWFATKYSGRVVHSTQSGRSLAIEVHAPTIT-RDVRGYALPRRDLICKITKIL 196 F + R F TKYSGRVV T RS+A+ V A I DVRGY LPRRDLICK+TKIL Sbjct: 37 FRLLNTRHFGTKYSGRVVRETSDRRSVAVRVEATGILPTDVRGYPLPRRDLICKVTKIL 95 >emb|CAN82028.1| hypothetical protein VITISV_000613 [Vitis vinifera] Length = 790 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/59 (61%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = +2 Query: 23 FNNITKRWFATKYSGRVVHSTQSGRSLAIEVHAPTIT-RDVRGYALPRRDLICKITKIL 196 F + R F TKYSGRVV T RS+A+ V A I DVRGY LPRRDLICK+TKIL Sbjct: 37 FRLLNTRHFGTKYSGRVVRETSDRRSVAVRVEATGILPTDVRGYPLPRRDLICKVTKIL 95 >gb|EXB74598.1| hypothetical protein L484_026295 [Morus notabilis] Length = 656 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/61 (52%), Positives = 45/61 (73%), Gaps = 1/61 (1%) Frame = +2 Query: 35 TKRWFATKYSGRVVHSTQSGRSLAIEVHAPT-ITRDVRGYALPRRDLICKITKILLQQQQ 211 T+R +ATKY+ ++ ++ +GRSL+ EV P + DVRGY LPRRDL+CK T+ILL+Q Sbjct: 19 TRRHYATKYTAKITSTSPTGRSLSAEVTPPPPLPSDVRGYPLPRRDLVCKATRILLRQSP 78 Query: 212 S 214 S Sbjct: 79 S 79 >ref|XP_004486474.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial-like [Cicer arietinum] Length = 664 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = +2 Query: 38 KRWFATKYSGRVVHSTQSGRSLAIEVHAPT-ITRDVRGYALPRRDLICKITKILLQQQQS 214 +R ATKY+ ++ ++ +GRSLA EV PT + DVRGY+LPRRDLICK T+ILL Sbjct: 27 RRHLATKYTAKITSTSPTGRSLAAEVTPPTPLPSDVRGYSLPRRDLICKATQILLSTNPH 86 Query: 215 P 217 P Sbjct: 87 P 87 >ref|XP_007147463.1| hypothetical protein PHAVU_006G126800g [Phaseolus vulgaris] gi|561020686|gb|ESW19457.1| hypothetical protein PHAVU_006G126800g [Phaseolus vulgaris] Length = 646 Score = 65.9 bits (159), Expect = 6e-09 Identities = 37/71 (52%), Positives = 44/71 (61%), Gaps = 1/71 (1%) Frame = +2 Query: 5 PHHYHHFNNITKRWFATKYSGRVVHSTQSGRSLAIEVHAPT-ITRDVRGYALPRRDLICK 181 PH +H +R FATKY+ R+ S +GRSLA EV P + D RGY LPRRDLICK Sbjct: 4 PHLFH-----LRRRFATKYTARITSSAPTGRSLAAEVTPPPPLPSDPRGYLLPRRDLICK 58 Query: 182 ITKILLQQQQS 214 T+ILL S Sbjct: 59 ATQILLSPPPS 69 >ref|XP_007045547.1| ABA Overly-Sensitive 5 isoform 1 [Theobroma cacao] gi|590697827|ref|XP_007045548.1| ABA Overly-Sensitive 5 isoform 1 [Theobroma cacao] gi|508709482|gb|EOY01379.1| ABA Overly-Sensitive 5 isoform 1 [Theobroma cacao] gi|508709483|gb|EOY01380.1| ABA Overly-Sensitive 5 isoform 1 [Theobroma cacao] Length = 648 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/69 (40%), Positives = 40/69 (57%) Frame = +2 Query: 11 HYHHFNNITKRWFATKYSGRVVHSTQSGRSLAIEVHAPTITRDVRGYALPRRDLICKITK 190 H+H + R +ATKY G++ ++ SGR L+ EV P + D RGY +PR LICK T Sbjct: 8 HFHQVITVNHRHYATKYIGKITSTSPSGRILSAEVSTPILPADSRGYPIPRHHLICKATH 67 Query: 191 ILLQQQQSP 217 +L + P Sbjct: 68 VLTKSPSDP 76 >gb|EYU24069.1| hypothetical protein MIMGU_mgv1a002658mg [Mimulus guttatus] Length = 649 Score = 64.3 bits (155), Expect = 2e-08 Identities = 35/65 (53%), Positives = 44/65 (67%), Gaps = 3/65 (4%) Frame = +2 Query: 11 HYHHFNNIT-KRWFATKYSGRVVHSTQSGRSLAIEVHA--PTITRDVRGYALPRRDLICK 181 HYH + +R +ATKY+G+VV +T GR AIEV PT+ D+RGY L RR+LICK Sbjct: 2 HYHRRGTLLLRRGYATKYTGKVVTTTNHGRLSAIEVCVTPPTLASDLRGYPLLRRELICK 61 Query: 182 ITKIL 196 TKIL Sbjct: 62 ATKIL 66 >ref|XP_006597666.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial-like [Glycine max] Length = 648 Score = 64.3 bits (155), Expect = 2e-08 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 1/66 (1%) Frame = +2 Query: 5 PHHYHHFNNITKRWFATKYSGRVVHSTQSGRSLAIEVHAPT-ITRDVRGYALPRRDLICK 181 PH H +R FATKY+ ++ +T +GRSLA EV P + D RGY LPRRDLICK Sbjct: 4 PHLLH-----LRRHFATKYTAKITSTTATGRSLAAEVTVPPPLPSDPRGYLLPRRDLICK 58 Query: 182 ITKILL 199 T+ILL Sbjct: 59 ATQILL 64 >gb|EPS67014.1| hypothetical protein M569_07760, partial [Genlisea aurea] Length = 640 Score = 63.2 bits (152), Expect = 4e-08 Identities = 35/64 (54%), Positives = 43/64 (67%), Gaps = 2/64 (3%) Frame = +2 Query: 32 ITKRWFATKYSGRVVHSTQSGRSLAIEVH--APTITRDVRGYALPRRDLICKITKILLQQ 205 + +R +ATKY+G VV +T+ G AIEV AP I DVRGY LPRR+LIC+ TK LL Sbjct: 1 VFRRGYATKYTGSVVTTTKKGNFSAIEVSVSAPDIVADVRGYPLPRRELICRATK-LLSS 59 Query: 206 QQSP 217 SP Sbjct: 60 DSSP 63 >ref|XP_004305254.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 652 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/61 (47%), Positives = 44/61 (72%), Gaps = 1/61 (1%) Frame = +2 Query: 35 TKRWFATKYSGRVVHSTQSGRSLAIEVHAPT-ITRDVRGYALPRRDLICKITKILLQQQQ 211 T R +ATKY+ +V ++ +GR+L++EV P + D+RGY L RRDL+CK T+I+L Q + Sbjct: 15 THRHYATKYTAKVTSTSPTGRTLSVEVTPPPPLPTDIRGYTLTRRDLVCKATQIILHQSR 74 Query: 212 S 214 S Sbjct: 75 S 75 >ref|XP_007215014.1| hypothetical protein PRUPE_ppa002515mg [Prunus persica] gi|462411164|gb|EMJ16213.1| hypothetical protein PRUPE_ppa002515mg [Prunus persica] Length = 663 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 1/60 (1%) Frame = +2 Query: 38 KRWFATKYSGRVVHSTQSGRSLAIEVHAPT-ITRDVRGYALPRRDLICKITKILLQQQQS 214 +R +ATKY+ ++ ++ +G S++ EV P + D+RGYALPRRDLICK T+ILL+Q S Sbjct: 26 RRHYATKYTAKITSTSPTGLSVSAEVTPPPPLPTDIRGYALPRRDLICKATQILLRQSPS 85 >ref|XP_003594555.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355483603|gb|AES64806.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 639 Score = 62.0 bits (149), Expect = 8e-08 Identities = 33/66 (50%), Positives = 43/66 (65%), Gaps = 1/66 (1%) Frame = +2 Query: 5 PHHYHHFNNITKRWFATKYSGRVVHSTQSGRSLAIEVHAPT-ITRDVRGYALPRRDLICK 181 PHH+H +R FATKY+ ++ ++ +GRSLA EV P + D GY LPR DLICK Sbjct: 3 PHHHH-----LRRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPSDPLGYNLPRPDLICK 57 Query: 182 ITKILL 199 T+ILL Sbjct: 58 ATQILL 63 >ref|XP_006392974.1| hypothetical protein EUTSA_v10011294mg [Eutrema salsugineum] gi|557089552|gb|ESQ30260.1| hypothetical protein EUTSA_v10011294mg [Eutrema salsugineum] Length = 662 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 41 RWFATKYSGRVVHSTQSGRSLAIEVHAPT-ITRDVRGYALPRRDLICKITKILLQ 202 R +ATKY +V S+ SGRSL+ E+ PT + DVRGY LPRR LIC+ T +LLQ Sbjct: 22 RSYATKYVAKVTSSSPSGRSLSAEISLPTPLPADVRGYPLPRRHLICRATNLLLQ 76 >ref|XP_004163164.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial-like [Cucumis sativus] Length = 685 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/56 (53%), Positives = 41/56 (73%), Gaps = 1/56 (1%) Frame = +2 Query: 41 RWFATKYSGRVVHSTQSGRSLAIEVHAP-TITRDVRGYALPRRDLICKITKILLQQ 205 R FATKY+ ++ S+ +GRS+A+ V P T+ D RGYALPRRDLIC++ ILL + Sbjct: 46 RHFATKYTAKITSSSPTGRSVAVVVTPPATLPVDSRGYALPRRDLICRVIDILLHR 101 >ref|XP_004150337.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial-like [Cucumis sativus] Length = 690 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/56 (51%), Positives = 41/56 (73%), Gaps = 1/56 (1%) Frame = +2 Query: 41 RWFATKYSGRVVHSTQSGRSLAIEVHAP-TITRDVRGYALPRRDLICKITKILLQQ 205 R FATKY+ ++ S+ +GRS+A+ V P T+ D RGYALPRRDLIC++ +LL + Sbjct: 51 RHFATKYTAKITSSSPTGRSVAVVVTPPATLPVDSRGYALPRRDLICRVIDMLLHR 106 >ref|XP_006426850.1| hypothetical protein CICLE_v10025103mg [Citrus clementina] gi|557528840|gb|ESR40090.1| hypothetical protein CICLE_v10025103mg [Citrus clementina] Length = 656 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 6/75 (8%) Frame = +2 Query: 8 HHYHHFNNIT-----KRWFATKYSGRVVHSTQSGRSLAIEVHAPT-ITRDVRGYALPRRD 169 H +NNI +R +ATKY ++ ++ +GRS+ EV P I D RGY +PRR Sbjct: 2 HRRRRYNNIMCVTVRRRHYATKYIAKITSTSPTGRSVTAEVTPPQPIPSDTRGYPIPRRH 61 Query: 170 LICKITKILLQQQQS 214 +ICK T +LLQ + S Sbjct: 62 VICKATNLLLQSRPS 76 >ref|XP_002894344.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297340186|gb|EFH70603.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 650 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 4/66 (6%) Frame = +2 Query: 14 YHHFNNITK---RWFATKYSGRVVHSTQSGRSLAIEVHAPT-ITRDVRGYALPRRDLICK 181 ++ N IT+ R +ATKY +V S+ SGRSL+ EV P + DVRGY LPRR LIC+ Sbjct: 9 FNSVNTITRPNRRQYATKYVAKVTSSSPSGRSLSAEVSLPNPLPADVRGYPLPRRHLICR 68 Query: 182 ITKILL 199 T +++ Sbjct: 69 ATNLII 74 >ref|NP_683419.1| ABA Overly-Sensitive 5 protein [Arabidopsis thaliana] gi|75216707|sp|Q9ZU27.1|PPR76_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g51965, mitochondrial; Flags: Precursor gi|4220445|gb|AAD12672.1| Similar to gi|3004555 F19F24.14 salt inducible protein homolog from Arabidopsis thaliana BAC gb|AC003673 [Arabidopsis thaliana] gi|332194619|gb|AEE32740.1| ABA Overly-Sensitive 5 protein [Arabidopsis thaliana] Length = 650 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/65 (47%), Positives = 42/65 (64%), Gaps = 4/65 (6%) Frame = +2 Query: 14 YHHFNNITK---RWFATKYSGRVVHSTQSGRSLAIEVHAPT-ITRDVRGYALPRRDLICK 181 ++ N IT+ R +ATKY +V S+ SGRSL+ EV P + DVRGY LPRR LIC+ Sbjct: 9 FNSVNTITRPNRRHYATKYVAKVTSSSPSGRSLSAEVSLPNPLPADVRGYPLPRRHLICR 68 Query: 182 ITKIL 196 T ++ Sbjct: 69 ATNLI 73