BLASTX nr result
ID: Cocculus23_contig00032101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00032101 (248 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME82323.1| hypothetical protein MYCFIDRAFT_211595 [Pseudocer... 63 4e-08 gb|EME43651.1| hypothetical protein DOTSEDRAFT_72870 [Dothistrom... 62 6e-08 >gb|EME82323.1| hypothetical protein MYCFIDRAFT_211595 [Pseudocercospora fijiensis CIRAD86] Length = 199 Score = 63.2 bits (152), Expect = 4e-08 Identities = 34/45 (75%), Positives = 36/45 (80%) Frame = +1 Query: 1 LIETVYSEFNSGAWLVDLGVFTPVCNSTSSKVKRNALGHLPFRML 135 LI TVYSEFNSGAWL DLGVFTP C +SSKVKR + G LP RML Sbjct: 158 LINTVYSEFNSGAWLYDLGVFTPTC--SSSKVKRTSNG-LPIRML 199 >gb|EME43651.1| hypothetical protein DOTSEDRAFT_72870 [Dothistroma septosporum NZE10] Length = 193 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = +1 Query: 1 LIETVYSEFNSGAWLVDLGVFTPVCNSTSSKVKRNALGHLPFRML 135 LI TVYSEFNSGAWL DLGVF P CN+T++ VKRN L P RM+ Sbjct: 150 LINTVYSEFNSGAWLYDLGVFVPSCNATAATVKRNLL-FKPRRMI 193