BLASTX nr result
ID: Cocculus23_contig00031854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00031854 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006297762.1| hypothetical protein CARUB_v10013797mg [Caps... 71 1e-10 ref|XP_002882545.1| kelch repeat-containing protein [Arabidopsis... 71 1e-10 ref|NP_566316.1| galactose oxidase/kelch repeat-containing prote... 71 1e-10 ref|XP_006407805.1| hypothetical protein EUTSA_v10021130mg [Eutr... 71 2e-10 emb|CBI28450.3| unnamed protein product [Vitis vinifera] 69 7e-10 ref|XP_002267128.1| PREDICTED: nitrile-specifier protein 5 [Viti... 69 7e-10 ref|XP_002459574.1| hypothetical protein SORBIDRAFT_02g006860 [S... 69 9e-10 ref|XP_002534363.1| Kelch domain-containing protein, putative [R... 69 9e-10 gb|AFK43803.1| unknown [Lotus japonicus] 68 1e-09 ref|XP_006364810.1| PREDICTED: nitrile-specifier protein 5-like ... 66 4e-09 ref|XP_004956398.1| PREDICTED: nitrile-specifier protein 5-like ... 66 4e-09 ref|XP_003569055.1| PREDICTED: nitrile-specifier protein 5-like ... 66 4e-09 ref|XP_007149302.1| hypothetical protein PHAVU_005G058900g [Phas... 66 6e-09 ref|XP_006447812.1| hypothetical protein CICLE_v10015897mg [Citr... 65 1e-08 ref|XP_004303569.1| PREDICTED: nitrile-specifier protein 5-like ... 65 1e-08 gb|EYU42773.1| hypothetical protein MIMGU_mgv1a010105mg [Mimulus... 64 2e-08 ref|XP_004239307.1| PREDICTED: nitrile-specifier protein 5-like ... 64 3e-08 dbj|BAD19903.1| putative D-protein [Oryza sativa Japonica Group] 64 3e-08 ref|NP_001062670.1| Os09g0249000 [Oryza sativa Japonica Group] g... 64 3e-08 gb|EEE69261.1| hypothetical protein OsJ_28516 [Oryza sativa Japo... 64 3e-08 >ref|XP_006297762.1| hypothetical protein CARUB_v10013797mg [Capsella rubella] gi|482566471|gb|EOA30660.1| hypothetical protein CARUB_v10013797mg [Capsella rubella] Length = 419 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFF 102 WCA+AAG DGKEGLLVYGGNSPSNDRLDDIFFF Sbjct: 381 WCAFAAGSRDGKEGLLVYGGNSPSNDRLDDIFFF 414 >ref|XP_002882545.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297328385|gb|EFH58804.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 332 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFFALN 111 WCA+AAG DGK+GLLVYGGNSPSNDRLDDIFFF N Sbjct: 289 WCAFAAGSRDGKQGLLVYGGNSPSNDRLDDIFFFTPN 325 >ref|NP_566316.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi|6466955|gb|AAF13090.1|AC009176_17 unknown protein [Arabidopsis thaliana] gi|6648184|gb|AAF21182.1|AC013483_6 unknown protein [Arabidopsis thaliana] gi|11692832|gb|AAG40019.1|AF324668_1 MLP3.17 [Arabidopsis thaliana] gi|11993873|gb|AAG42920.1|AF329503_1 unknown protein [Arabidopsis thaliana] gi|14517448|gb|AAK62614.1| AT3g07720/F17A17_6 [Arabidopsis thaliana] gi|21280883|gb|AAM44920.1| unknown protein [Arabidopsis thaliana] gi|23507767|gb|AAN38687.1| At3g07720/F17A17_6 [Arabidopsis thaliana] gi|332641071|gb|AEE74592.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] Length = 329 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFFALN 111 WCA+AAG DGK+GLLVYGGNSPSNDRLDDIFFF N Sbjct: 289 WCAFAAGSRDGKQGLLVYGGNSPSNDRLDDIFFFTPN 325 >ref|XP_006407805.1| hypothetical protein EUTSA_v10021130mg [Eutrema salsugineum] gi|557108951|gb|ESQ49258.1| hypothetical protein EUTSA_v10021130mg [Eutrema salsugineum] Length = 326 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFFALN 111 WCA+AAG DGK+GLLVYGGNSPSNDRLDDIFFF N Sbjct: 290 WCAFAAGSRDGKDGLLVYGGNSPSNDRLDDIFFFIPN 326 >emb|CBI28450.3| unnamed protein product [Vitis vinifera] Length = 275 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFFALNLD 117 WCA++AGRL KEGLLVYGGNSPSNDRLDDIFF + LD Sbjct: 233 WCAFSAGRLHDKEGLLVYGGNSPSNDRLDDIFFLSPCLD 271 >ref|XP_002267128.1| PREDICTED: nitrile-specifier protein 5 [Vitis vinifera] Length = 327 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFFALNLD 117 WCA++AGRL KEGLLVYGGNSPSNDRLDDIFF + LD Sbjct: 285 WCAFSAGRLHDKEGLLVYGGNSPSNDRLDDIFFLSPCLD 323 >ref|XP_002459574.1| hypothetical protein SORBIDRAFT_02g006860 [Sorghum bicolor] gi|241922951|gb|EER96095.1| hypothetical protein SORBIDRAFT_02g006860 [Sorghum bicolor] Length = 330 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFFA 105 WCA+AAG DG++GLLVYGGNSP+NDRLDDI+FFA Sbjct: 287 WCAFAAGEKDGRQGLLVYGGNSPTNDRLDDIYFFA 321 >ref|XP_002534363.1| Kelch domain-containing protein, putative [Ricinus communis] gi|223525429|gb|EEF28020.1| Kelch domain-containing protein, putative [Ricinus communis] Length = 327 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFFALNLD 117 WCA+A+G L GK GLLVYGGNSPSNDRLDDIFF L LD Sbjct: 285 WCAFASGSLGGKLGLLVYGGNSPSNDRLDDIFFLTLCLD 323 >gb|AFK43803.1| unknown [Lotus japonicus] Length = 325 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFFALN 111 WCA+A + DG+EGLLVYGGNSPSNDRLDDIFF AL+ Sbjct: 287 WCAFAGAQRDGREGLLVYGGNSPSNDRLDDIFFLALS 323 >ref|XP_006364810.1| PREDICTED: nitrile-specifier protein 5-like [Solanum tuberosum] Length = 325 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFF 102 WCA+A+GR DG+EG+LVYGGN+PSNDRL DIFFF Sbjct: 286 WCAFASGRRDGQEGMLVYGGNTPSNDRLGDIFFF 319 >ref|XP_004956398.1| PREDICTED: nitrile-specifier protein 5-like [Setaria italica] Length = 329 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFFA 105 WCA+AAG +G+ GLLVYGGNSP+NDRLDDI+FFA Sbjct: 288 WCAFAAGEKEGRRGLLVYGGNSPTNDRLDDIYFFA 322 >ref|XP_003569055.1| PREDICTED: nitrile-specifier protein 5-like [Brachypodium distachyon] Length = 342 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFFA 105 WCA++AG LDG+ G+LVYGGNSPSNDRL D+FFFA Sbjct: 305 WCAFSAGELDGRAGMLVYGGNSPSNDRLGDMFFFA 339 >ref|XP_007149302.1| hypothetical protein PHAVU_005G058900g [Phaseolus vulgaris] gi|561022566|gb|ESW21296.1| hypothetical protein PHAVU_005G058900g [Phaseolus vulgaris] Length = 328 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFFALN 111 WCA+A R G++GLLVYGGNSPSNDRLDDIFF AL+ Sbjct: 287 WCAFAGARQGGRQGLLVYGGNSPSNDRLDDIFFLALS 323 >ref|XP_006447812.1| hypothetical protein CICLE_v10015897mg [Citrus clementina] gi|568830316|ref|XP_006469447.1| PREDICTED: nitrile-specifier protein 5-like [Citrus sinensis] gi|557550423|gb|ESR61052.1| hypothetical protein CICLE_v10015897mg [Citrus clementina] Length = 329 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFFALNLD 117 WCA+A G GK GLLVYGGNSPSNDRLDDI+FF LD Sbjct: 287 WCAFAGGLRGGKHGLLVYGGNSPSNDRLDDIYFFTPCLD 325 >ref|XP_004303569.1| PREDICTED: nitrile-specifier protein 5-like [Fragaria vesca subsp. vesca] Length = 329 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFF 102 WCA+ G DG+ GLLVYGGNSPSNDRLDDIFFF Sbjct: 287 WCAFTGGERDGRVGLLVYGGNSPSNDRLDDIFFF 320 >gb|EYU42773.1| hypothetical protein MIMGU_mgv1a010105mg [Mimulus guttatus] Length = 322 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFF 102 WCA+ GR +GK+GL+VYGGNSPSNDRL DIFFF Sbjct: 285 WCAFGGGRKEGKDGLIVYGGNSPSNDRLGDIFFF 318 >ref|XP_004239307.1| PREDICTED: nitrile-specifier protein 5-like [Solanum lycopersicum] Length = 326 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFF 102 WCA+A+G+ DG+EGLLVYGGN+P NDRL DIFFF Sbjct: 287 WCAFASGQRDGQEGLLVYGGNTPCNDRLGDIFFF 320 >dbj|BAD19903.1| putative D-protein [Oryza sativa Japonica Group] Length = 330 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFF 102 WCA++AG +DG+ GLLVYGGNSP+NDRL DI+FF Sbjct: 292 WCAFSAGEVDGRRGLLVYGGNSPTNDRLGDIYFF 325 >ref|NP_001062670.1| Os09g0249000 [Oryza sativa Japonica Group] gi|46798901|emb|CAG27306.1| kelch repeat containing protein [Oryza sativa Japonica Group] gi|113630903|dbj|BAF24584.1| Os09g0249000 [Oryza sativa Japonica Group] gi|215706295|dbj|BAG93151.1| unnamed protein product [Oryza sativa Japonica Group] Length = 332 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFF 102 WCA++AG +DG+ GLLVYGGNSP+NDRL DI+FF Sbjct: 294 WCAFSAGEVDGRRGLLVYGGNSPTNDRLGDIYFF 327 >gb|EEE69261.1| hypothetical protein OsJ_28516 [Oryza sativa Japonica Group] Length = 286 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 1 WCAYAAGRLDGKEGLLVYGGNSPSNDRLDDIFFF 102 WCA++AG +DG+ GLLVYGGNSP+NDRL DI+FF Sbjct: 248 WCAFSAGEVDGRRGLLVYGGNSPTNDRLGDIYFF 281