BLASTX nr result
ID: Cocculus23_contig00031712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00031712 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006384843.1| hypothetical protein POPTR_0004s21560g [Popu... 60 3e-07 ref|XP_007200313.1| hypothetical protein PRUPE_ppa001249mg [Prun... 56 5e-06 ref|XP_002527150.1| pentatricopeptide repeat-containing protein,... 56 5e-06 >ref|XP_006384843.1| hypothetical protein POPTR_0004s21560g [Populus trichocarpa] gi|550341611|gb|ERP62640.1| hypothetical protein POPTR_0004s21560g [Populus trichocarpa] Length = 874 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +3 Query: 123 PSLSWHLFKHLLSSPTFKICNQFMPIIARILVRAKMLQEIDQLHQLVL 266 P +SW+LFK +LS P + C Q +PII RIL+RAKML E+D L QL++ Sbjct: 19 PKISWYLFKRILSLPVTQQCPQSIPIITRILIRAKMLNELDDLPQLLI 66 >ref|XP_007200313.1| hypothetical protein PRUPE_ppa001249mg [Prunus persica] gi|462395713|gb|EMJ01512.1| hypothetical protein PRUPE_ppa001249mg [Prunus persica] Length = 872 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/53 (50%), Positives = 37/53 (69%), Gaps = 4/53 (7%) Frame = +3 Query: 123 PSLSWHLFKHLLSSPTFK----ICNQFMPIIARILVRAKMLQEIDQLHQLVLL 269 P L+WHLFK +LSSPT +C + +PI+ RIL+ +KM EID L QL+L+ Sbjct: 18 PKLAWHLFKRILSSPTSSSSSDLCLRSLPIVTRILIDSKMHHEIDSLRQLLLV 70 >ref|XP_002527150.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533489|gb|EEF35232.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 874 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/49 (55%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +3 Query: 123 PSLSWHLFKHLLSSP-TFKICNQFMPIIARILVRAKMLQEIDQLHQLVL 266 P L+WHLFK +LS P + +Q +PII+RIL+R+KM E+D LHQL+L Sbjct: 18 PKLAWHLFKRILSLPISSNHRSQSIPIISRILIRSKMFNELDDLHQLLL 66