BLASTX nr result
ID: Cocculus23_contig00031576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00031576 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61798.1| hypothetical protein VITISV_044291 [Vitis vinifera] 48 2e-07 ref|XP_006371212.1| hypothetical protein POPTR_0019s06065g [Popu... 42 8e-06 >emb|CAN61798.1| hypothetical protein VITISV_044291 [Vitis vinifera] Length = 563 Score = 48.1 bits (113), Expect(2) = 2e-07 Identities = 21/43 (48%), Positives = 30/43 (69%) Frame = +3 Query: 3 YVAIVLDPRFKMGLVKYSFDFLYGSEVGGEMTKMVDSILRRLY 131 YV +VLDPR+K+ V++ FD LY EV +M+ V +LR+LY Sbjct: 352 YVVVVLDPRYKLKFVQFCFDQLYDKEVAKDMSTRVVDVLRKLY 394 Score = 32.7 bits (73), Expect(2) = 2e-07 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +2 Query: 227 FRRHLDEVNNMEYKTEVDRYLAESLEK 307 F RHL E +N+E K+E+D YL+ES E+ Sbjct: 432 FTRHLYEEHNVESKSELDWYLSESNER 458 >ref|XP_006371212.1| hypothetical protein POPTR_0019s06065g [Populus trichocarpa] gi|550316909|gb|ERP49009.1| hypothetical protein POPTR_0019s06065g [Populus trichocarpa] Length = 577 Score = 42.0 bits (97), Expect(2) = 8e-06 Identities = 21/43 (48%), Positives = 26/43 (60%) Frame = +3 Query: 3 YVAIVLDPRFKMGLVKYSFDFLYGSEVGGEMTKMVDSILRRLY 131 YVA+VLDPRFK+ V++ F LY E G T V L RL+ Sbjct: 369 YVAVVLDPRFKLKYVRFCFGRLYDVEEAGNFTFKVKDTLIRLF 411 Score = 33.1 bits (74), Expect(2) = 8e-06 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +2 Query: 209 DPITKRFRRHLDEVNNMEYKTEVDRYLAESLE 304 D + +F++HL+E ++ K EV+RYL + E Sbjct: 448 DDLASQFKKHLEEEGGVQKKNEVERYLGDDCE 479