BLASTX nr result
ID: Cocculus23_contig00031225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00031225 (226 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006475766.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_006451033.1| hypothetical protein CICLE_v10010814mg, part... 60 2e-07 ref|NP_189568.1| pentatricopeptide repeat-containing protein [Ar... 60 3e-07 gb|EXC04260.1| hypothetical protein L484_002345 [Morus notabilis] 59 7e-07 ref|NP_188283.1| pentatricopeptide repeat-containing protein [Ar... 59 7e-07 emb|CBI28135.3| unnamed protein product [Vitis vinifera] 59 7e-07 ref|XP_002281645.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_002875497.1| pentatricopeptide repeat-containing protein ... 58 1e-06 ref|XP_004289579.1| PREDICTED: putative pentatricopeptide repeat... 58 2e-06 ref|XP_004161713.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 58 2e-06 ref|XP_004142727.1| PREDICTED: putative pentatricopeptide repeat... 58 2e-06 ref|XP_006464333.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_006352207.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_006445525.1| hypothetical protein CICLE_v10019817mg [Citr... 57 2e-06 ref|XP_004503024.1| PREDICTED: putative pentatricopeptide repeat... 57 2e-06 ref|XP_002885157.1| pentatricopeptide repeat-containing protein ... 57 2e-06 ref|XP_006431157.1| hypothetical protein CICLE_v10011507mg [Citr... 57 3e-06 ref|XP_006395295.1| hypothetical protein EUTSA_v10003866mg [Eutr... 57 3e-06 ref|XP_002310258.2| pentatricopeptide repeat-containing family p... 57 3e-06 ref|XP_002318314.2| hypothetical protein POPTR_0012s03810g [Popu... 57 3e-06 >ref|XP_006475766.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55740, chloroplastic-like isoform X1 [Citrus sinensis] Length = 840 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEM 75 HGLA+EAL LF +Q+ GI PDS+T T++L ACSHAG+V GL++ M Sbjct: 634 HGLAVEALALFKNLQQKGIDPDSITFTNILNACSHAGLVNEGLELFVGM 682 >ref|XP_006451033.1| hypothetical protein CICLE_v10010814mg, partial [Citrus clementina] gi|557554259|gb|ESR64273.1| hypothetical protein CICLE_v10010814mg, partial [Citrus clementina] Length = 830 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEM 75 HGLA+EAL LF +Q+ GI PDS+T T++L ACSHAG+V GL++ M Sbjct: 634 HGLAVEALALFKNLQQKGIDPDSITFTNILNACSHAGLVNEGLELFVGM 682 >ref|NP_189568.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75273910|sp|Q9LS72.1|PP261_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g29230 gi|9293916|dbj|BAB01819.1| unnamed protein product [Arabidopsis thaliana] gi|332644032|gb|AEE77553.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 600 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/52 (51%), Positives = 34/52 (65%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEMSKV 66 HG EA+ LFS M+R GI PD VT VLC+C+HAG++ G+ Y M KV Sbjct: 394 HGHGKEAIELFSRMRREGIRPDKVTFIAVLCSCNHAGLIDEGIDYFYSMEKV 445 >gb|EXC04260.1| hypothetical protein L484_002345 [Morus notabilis] Length = 1455 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEMSKV 66 HG+ EAL +FS M +G+ PD V +T VL ACSHAG+++ GL+ Y + KV Sbjct: 1028 HGMGKEALGIFSHMLEMGLKPDHVIITAVLSACSHAGLMSEGLETFYSIEKV 1079 >ref|NP_188283.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75274288|sp|Q9LUS3.1|PP237_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g16610 gi|11994615|dbj|BAB02752.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332642322|gb|AEE75843.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 654 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEMSK 69 HGL EAL+LF+ MQ G++PD VTL +L ACSH+G+V G Q+ MS+ Sbjct: 488 HGLGKEALSLFNSMQETGVNPDEVTLLAILSACSHSGLVDEGKQLFNSMSR 538 >emb|CBI28135.3| unnamed protein product [Vitis vinifera] Length = 1974 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEM 75 HG A+EAL LF +Q+ GI PDS+T T +L ACSHAG+V GL + +M Sbjct: 1729 HGQAVEALALFKHLQKEGIEPDSITFTSILSACSHAGLVNEGLNLFADM 1777 >ref|XP_002281645.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55740, chloroplastic-like [Vitis vinifera] Length = 858 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEM 75 HG A+EAL LF +Q+ GI PDS+T T +L ACSHAG+V GL + +M Sbjct: 634 HGQAVEALALFKHLQKEGIEPDSITFTSILSACSHAGLVNEGLNLFADM 682 >ref|XP_002875497.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297321335|gb|EFH51756.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 629 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/52 (50%), Positives = 34/52 (65%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEMSKV 66 HG EA+ LFS M++ GI PD VT VLC+C+HAG++ G+ Y M KV Sbjct: 394 HGHGKEAIELFSRMRKEGIWPDKVTFIAVLCSCNHAGLIDEGIDYFYSMEKV 445 >ref|XP_004289579.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490-like [Fragaria vesca subsp. vesca] Length = 883 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEMSKV 66 HG+ EAL +FS M +GI PD+V +T VL ACSHAG+V GL++ + + +V Sbjct: 682 HGMGEEALRIFSHMLELGIKPDNVIITAVLSACSHAGLVNEGLKIFHTIEEV 733 >ref|XP_004161713.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g47840-like [Cucumis sativus] Length = 712 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEMSK 69 HG + EA+ LF +Q+VG+ PDSVT VL ACSHAGMV +G MSK Sbjct: 498 HGHSQEAIELFENIQKVGLRPDSVTFIGVLTACSHAGMVDLGFYYFNSMSK 548 >ref|XP_004142727.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g47840-like [Cucumis sativus] Length = 712 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEMSK 69 HG + EA+ LF +Q+VG+ PDSVT VL ACSHAGMV +G MSK Sbjct: 498 HGHSQEAIELFENIQKVGLRPDSVTFIGVLTACSHAGMVDLGFYYFNSMSK 548 >ref|XP_006464333.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Citrus sinensis] Length = 608 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEMSKV 66 HG A +AL++FS M +VGI PD VT VL ACSHAG+V G + +MS+V Sbjct: 404 HGKAWKALDIFSEMSQVGIEPDEVTFVGVLSACSHAGLVEEGCKHFLDMSRV 455 >ref|XP_006352207.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55740, chloroplastic-like [Solanum tuberosum] Length = 844 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/52 (50%), Positives = 35/52 (67%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEMSKV 66 HG A+EAL LF + + G+ PDS+T T VL +C HAG++ GL V Y+M V Sbjct: 638 HGRAIEALALFKRLCKEGVEPDSITFTSVLSSCCHAGLIKEGLDVFYDMLSV 689 >ref|XP_006445525.1| hypothetical protein CICLE_v10019817mg [Citrus clementina] gi|557547787|gb|ESR58765.1| hypothetical protein CICLE_v10019817mg [Citrus clementina] Length = 501 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEMSKV 66 HG A +AL++FS M +VGI PD VT VL ACSHAG+V G + +MS+V Sbjct: 297 HGKAWKALDIFSEMSQVGIEPDEVTFVGVLSACSHAGLVEEGCKHFLDMSRV 348 >ref|XP_004503024.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490-like [Cicer arietinum] Length = 874 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/52 (48%), Positives = 34/52 (65%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEMSKV 66 HG+ EAL+ FS M +GI PD V T +L ACSHAG + GL++ Y + K+ Sbjct: 671 HGMGKEALSTFSQMLNLGIKPDHVIFTSILSACSHAGRIDEGLKIFYSIEKI 722 >ref|XP_002885157.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330997|gb|EFH61416.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 655 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEMSK 69 HGL EAL+LF+ MQ G+ PD VTL +L ACSH+G+V G Q+ MS+ Sbjct: 488 HGLGKEALSLFNSMQDTGVHPDEVTLLAILSACSHSGLVDEGKQLFNSMSR 538 >ref|XP_006431157.1| hypothetical protein CICLE_v10011507mg [Citrus clementina] gi|557533214|gb|ESR44397.1| hypothetical protein CICLE_v10011507mg [Citrus clementina] Length = 514 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/52 (55%), Positives = 34/52 (65%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEMSKV 66 HG A EAL LFS M+ ISP+ VT VLCAC+HAGMV G + +EM V Sbjct: 309 HGYAEEALELFSNMKNSSISPNYVTFLGVLCACNHAGMVEDGYRYFHEMEHV 360 >ref|XP_006395295.1| hypothetical protein EUTSA_v10003866mg [Eutrema salsugineum] gi|557091934|gb|ESQ32581.1| hypothetical protein EUTSA_v10003866mg [Eutrema salsugineum] Length = 598 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/51 (49%), Positives = 33/51 (64%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEMSK 69 HG +A+ LFS M+R G+ PD VT VLC+C+HAG+V G+ Y M K Sbjct: 392 HGHGKKAIELFSRMRREGVRPDKVTFIAVLCSCNHAGLVDEGIDYFYSMEK 442 >ref|XP_002310258.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550334781|gb|EEE90708.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 666 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/52 (50%), Positives = 35/52 (67%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEMSKV 66 HG + EA++LF + +VG+ PDSVT VL ACSHAG+V +G +SKV Sbjct: 450 HGYSQEAIDLFKKLPKVGLRPDSVTFIAVLAACSHAGLVDLGFHYFNSLSKV 501 >ref|XP_002318314.2| hypothetical protein POPTR_0012s03810g [Populus trichocarpa] gi|550326327|gb|EEE96534.2| hypothetical protein POPTR_0012s03810g [Populus trichocarpa] Length = 643 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = -3 Query: 221 HGLAMEALNLFS*MQRVGISPDSVTLTHVLCACSHAGMVTVGLQVLYEMSK 69 HG EAL +F M+RVG+ PD VTL VL ACSH+GM+ G++ MSK Sbjct: 350 HGRGKEALEVFDEMRRVGLQPDGVTLLVVLYACSHSGMIDQGIEFFNSMSK 400