BLASTX nr result
ID: Cocculus23_contig00030989
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00030989 (254 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006847924.1| hypothetical protein AMTR_s00029p00122290 [A... 60 2e-07 >ref|XP_006847924.1| hypothetical protein AMTR_s00029p00122290 [Amborella trichopoda] gi|548851229|gb|ERN09505.1| hypothetical protein AMTR_s00029p00122290 [Amborella trichopoda] Length = 667 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 252 FRGALSKLGLLSEFALQMVQGAIRPQRQTVLVQDENQSLENA 127 FR ALS++G + FALQ VQ AI+PQ+QTVLVQDENQSLENA Sbjct: 39 FRRALSQVGPPANFALQTVQEAIKPQKQTVLVQDENQSLENA 80