BLASTX nr result
ID: Cocculus23_contig00030876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00030876 (595 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007216409.1| hypothetical protein PRUPE_ppa022709mg, part... 59 8e-07 ref|XP_004304947.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 emb|CBI36352.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002264123.1| PREDICTED: putative pentatricopeptide repeat... 57 3e-06 ref|XP_002517451.1| pentatricopeptide repeat-containing protein,... 57 4e-06 gb|EXB36666.1| hypothetical protein L484_002079 [Morus notabilis] 57 5e-06 >ref|XP_007216409.1| hypothetical protein PRUPE_ppa022709mg, partial [Prunus persica] gi|462412559|gb|EMJ17608.1| hypothetical protein PRUPE_ppa022709mg, partial [Prunus persica] Length = 541 Score = 59.3 bits (142), Expect = 8e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -3 Query: 590 GIKKTPGCSLVEVNGEVNEFVSGDVLHCRQLEIGAILDFL 471 GIKKTPGCS++EV+G+VNEFVSGDV H Q I A+LD + Sbjct: 439 GIKKTPGCSMIEVDGKVNEFVSGDVSHSHQAWICAMLDLI 478 >ref|XP_004304947.1| PREDICTED: pentatricopeptide repeat-containing protein At3g28660-like [Fragaria vesca subsp. vesca] Length = 501 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -3 Query: 593 RGIKKTPGCSLVEVNGEVNEFVSGDVLHCRQLEIGAILDFLS 468 +GIKKTPGCS++EV+G+VNEFVSGDV H ++I +LD +S Sbjct: 453 KGIKKTPGCSMLEVDGKVNEFVSGDVSHSHCVQICTMLDLIS 494 >emb|CBI36352.3| unnamed protein product [Vitis vinifera] Length = 605 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -3 Query: 593 RGIKKTPGCSLVEVNGEVNEFVSGDVLHCRQLEIGAILDFLSLQM 459 RGIKKTPGCSL+E+NG V+EFV+GD +H + EI + LD +S+ + Sbjct: 465 RGIKKTPGCSLIEMNGSVHEFVAGDQVHPQSKEIYSKLDEMSVDL 509 >ref|XP_002264123.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930 [Vitis vinifera] Length = 724 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -3 Query: 593 RGIKKTPGCSLVEVNGEVNEFVSGDVLHCRQLEIGAILDFLSLQM 459 RGIKKTPGCSL+E+NG V+EFV+GD +H + EI + LD +S+ + Sbjct: 584 RGIKKTPGCSLIEMNGSVHEFVAGDQVHPQSKEIYSKLDEMSVDL 628 >ref|XP_002517451.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543462|gb|EEF44993.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 428 Score = 57.0 bits (136), Expect = 4e-06 Identities = 28/55 (50%), Positives = 39/55 (70%) Frame = -3 Query: 593 RGIKKTPGCSLVEVNGEVNEFVSGDVLHCRQLEIGAILDFLSLQMIDHHSREDQI 429 RG+KKTPGCS++EVNG VNEFVSGDV + ++ AIL+ L +I E+++ Sbjct: 367 RGLKKTPGCSMIEVNGMVNEFVSGDVSNKDVAQMHAILELLLPDLITPSFVEEKV 421 >gb|EXB36666.1| hypothetical protein L484_002079 [Morus notabilis] Length = 487 Score = 56.6 bits (135), Expect = 5e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -3 Query: 593 RGIKKTPGCSLVEVNGEVNEFVSGDVLHCRQLEIGAILDFLSLQMI 456 +GI+KTPGCS VEV+G VNEFVSGD++H Q +I +L LS I Sbjct: 423 KGIRKTPGCSTVEVDGRVNEFVSGDIVHSCQAKICVMLYLLSSNSI 468