BLASTX nr result
ID: Cocculus23_contig00030874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00030874 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006348310.1| PREDICTED: peptide-N4-(N-acetyl-beta-glucosa... 58 1e-06 ref|XP_002524519.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)aspar... 56 5e-06 >ref|XP_006348310.1| PREDICTED: peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A-like [Solanum tuberosum] Length = 583 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = -3 Query: 262 SQQVYKYDGYSDCYFRNVSSTNYTIIYDKAIEACSETWKNVS 137 +QQ+YKY+ CYFRN+SS+NYT++YDK I +CS+ VS Sbjct: 542 TQQIYKYNNDKGCYFRNISSSNYTVLYDKVINSCSKLINTVS 583 >ref|XP_002524519.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A, putative [Ricinus communis] gi|223536193|gb|EEF37846.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A, putative [Ricinus communis] Length = 624 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -3 Query: 262 SQQVYKYDGYSDCYFRNVSSTNYTIIYDKAIEACSE 155 +QQVYKYDG CYFRNVSS+NYTI+YDK C++ Sbjct: 556 TQQVYKYDGDKFCYFRNVSSSNYTILYDKVGNKCNK 591