BLASTX nr result
ID: Cocculus23_contig00030873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00030873 (493 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME48691.1| hypothetical protein DOTSEDRAFT_67657 [Dothistrom... 46 2e-06 >gb|EME48691.1| hypothetical protein DOTSEDRAFT_67657 [Dothistroma septosporum NZE10] Length = 288 Score = 46.2 bits (108), Expect(2) = 2e-06 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -1 Query: 493 YTSGYGKRKFWQRRPKHEMNKDAELGTTGTA 401 YTSG+GK+KFWQR+PK +D ELG G A Sbjct: 194 YTSGFGKKKFWQRKPKDTTIRDTELGAGGLA 224 Score = 31.2 bits (69), Expect(2) = 2e-06 Identities = 11/14 (78%), Positives = 14/14 (100%) Frame = -2 Query: 285 HSGYHTQPQGSGVN 244 H+GY+TQPQG+GVN Sbjct: 260 HTGYYTQPQGAGVN 273