BLASTX nr result
ID: Cocculus23_contig00030745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00030745 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273023.1| PREDICTED: tRNA-specific adenosine deaminase... 65 1e-08 ref|XP_003618981.1| Double-stranded RNA-specific adenosine deami... 64 3e-08 ref|XP_004510811.1| PREDICTED: tRNA-specific adenosine deaminase... 62 8e-08 ref|XP_004510810.1| PREDICTED: tRNA-specific adenosine deaminase... 62 8e-08 emb|CAN70737.1| hypothetical protein VITISV_008287 [Vitis vinifera] 61 1e-07 ref|XP_007051851.1| Adenosine deaminases,RNA binding,RNA binding... 59 5e-07 ref|XP_007135036.1| hypothetical protein PHAVU_010G096200g [Phas... 58 1e-06 ref|XP_007135035.1| hypothetical protein PHAVU_010G096200g [Phas... 58 1e-06 ref|XP_004308387.1| PREDICTED: tRNA-specific adenosine deaminase... 58 2e-06 ref|XP_006583312.1| PREDICTED: tRNA-specific adenosine deaminase... 57 3e-06 ref|XP_006375332.1| hypothetical protein POPTR_0014s07720g [Popu... 57 3e-06 ref|XP_002320118.2| adenosine-deaminase family protein [Populus ... 57 3e-06 >ref|XP_002273023.1| PREDICTED: tRNA-specific adenosine deaminase 1 [Vitis vinifera] gi|297745247|emb|CBI40327.3| unnamed protein product [Vitis vinifera] Length = 453 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = +3 Query: 3 LMEGCSSRIQADDISYRELKAGAQEYRSALKILRGSLPFSNWILKPLDLEAFSI 164 LM S A+++SYRELK GAQEY SA KI +GS PF+ W+LK L+LEAFS+ Sbjct: 398 LMHKTSIESPANEVSYRELKDGAQEYCSASKIFKGSPPFNGWLLKALNLEAFSV 451 >ref|XP_003618981.1| Double-stranded RNA-specific adenosine deaminase [Medicago truncatula] gi|355493996|gb|AES75199.1| Double-stranded RNA-specific adenosine deaminase [Medicago truncatula] Length = 413 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +3 Query: 36 DDISYRELKAGAQEYRSALKILRGSLPFSNWILKPLDLEAFSI 164 DDI+YRELK GA+EY A KI +G PFSNW +KPLD EAF I Sbjct: 369 DDITYRELKDGAEEYHLASKIFKGKPPFSNWFVKPLDCEAFPI 411 >ref|XP_004510811.1| PREDICTED: tRNA-specific adenosine deaminase 1-like isoform X2 [Cicer arietinum] Length = 400 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = +3 Query: 3 LMEGCSSRIQADDISYRELKAGAQEYRSALKILRGSLPFSNWILKPLDLEAFSI 164 L + C + ++I+YRELK GA+EY A KI +G PFSNW +KPLD E FSI Sbjct: 345 LRKECLTECLDNEITYRELKDGAEEYHLASKIFKGKPPFSNWFVKPLDCEKFSI 398 >ref|XP_004510810.1| PREDICTED: tRNA-specific adenosine deaminase 1-like isoform X1 [Cicer arietinum] Length = 404 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = +3 Query: 3 LMEGCSSRIQADDISYRELKAGAQEYRSALKILRGSLPFSNWILKPLDLEAFSI 164 L + C + ++I+YRELK GA+EY A KI +G PFSNW +KPLD E FSI Sbjct: 349 LRKECLTECLDNEITYRELKDGAEEYHLASKIFKGKPPFSNWFVKPLDCEKFSI 402 >emb|CAN70737.1| hypothetical protein VITISV_008287 [Vitis vinifera] Length = 694 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/54 (55%), Positives = 38/54 (70%) Frame = +3 Query: 3 LMEGCSSRIQADDISYRELKAGAQEYRSALKILRGSLPFSNWILKPLDLEAFSI 164 LM S A+++ YRELK GAQEY SA KI +GS PF+ W+LK L+LEAF + Sbjct: 265 LMHKTSIESPANEVXYRELKDGAQEYCSASKIFKGSPPFNGWLLKALNLEAFXV 318 >ref|XP_007051851.1| Adenosine deaminases,RNA binding,RNA binding,adenosine deaminases, putative isoform 1 [Theobroma cacao] gi|508704112|gb|EOX96008.1| Adenosine deaminases,RNA binding,RNA binding,adenosine deaminases, putative isoform 1 [Theobroma cacao] Length = 426 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/54 (50%), Positives = 37/54 (68%) Frame = +3 Query: 3 LMEGCSSRIQADDISYRELKAGAQEYRSALKILRGSLPFSNWILKPLDLEAFSI 164 L + C + ++++SYRELK A EY SA K+ +G PF W+LKPL+LE FSI Sbjct: 356 LRQECQIKCSSNEVSYRELKDRAGEYNSASKLFKGRPPFHTWLLKPLNLENFSI 409 >ref|XP_007135036.1| hypothetical protein PHAVU_010G096200g [Phaseolus vulgaris] gi|561008081|gb|ESW07030.1| hypothetical protein PHAVU_010G096200g [Phaseolus vulgaris] Length = 410 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = +3 Query: 33 ADDISYRELKAGAQEYRSALKILRGSLPFSNWILKPLDLEAFSI 164 A+ I+YRELK G +EY+ A KI +G PF+ W LKPLD EAF I Sbjct: 365 ANGITYRELKDGTEEYKLASKIFKGKAPFNRWFLKPLDCEAFPI 408 >ref|XP_007135035.1| hypothetical protein PHAVU_010G096200g [Phaseolus vulgaris] gi|561008080|gb|ESW07029.1| hypothetical protein PHAVU_010G096200g [Phaseolus vulgaris] Length = 260 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = +3 Query: 33 ADDISYRELKAGAQEYRSALKILRGSLPFSNWILKPLDLEAFSI 164 A+ I+YRELK G +EY+ A KI +G PF+ W LKPLD EAF I Sbjct: 215 ANGITYRELKDGTEEYKLASKIFKGKAPFNRWFLKPLDCEAFPI 258 >ref|XP_004308387.1| PREDICTED: tRNA-specific adenosine deaminase 1-like [Fragaria vesca subsp. vesca] Length = 416 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = +3 Query: 3 LMEGCSSRIQADDISYRELKAGAQEYRSALKILRGSLPFSNWILKPLDLEAFS 161 L C ++I ++ISYRE+K A EY + K+L+ + FSNW+LKP DLE FS Sbjct: 360 LRNECPTKIHVNEISYREIKERAYEYNATSKVLKRTHTFSNWLLKPPDLETFS 412 >ref|XP_006583312.1| PREDICTED: tRNA-specific adenosine deaminase 1-like [Glycine max] Length = 410 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = +3 Query: 42 ISYRELKAGAQEYRSALKILRGSLPFSNWILKPLDLEAFSI 164 I+YRELK GA+EY A KI +G PF+ W LKPLD EAF I Sbjct: 368 ITYRELKDGAEEYHLASKIFKGKPPFNKWFLKPLDCEAFHI 408 >ref|XP_006375332.1| hypothetical protein POPTR_0014s07720g [Populus trichocarpa] gi|550323731|gb|ERP53129.1| hypothetical protein POPTR_0014s07720g [Populus trichocarpa] Length = 418 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/54 (55%), Positives = 34/54 (62%) Frame = +3 Query: 3 LMEGCSSRIQADDISYRELKAGAQEYRSALKILRGSLPFSNWILKPLDLEAFSI 164 L + S+ A DISYRELK AQ Y S K + S F+NW LKPLD EAFSI Sbjct: 362 LKQEFQSKCPAKDISYRELKNNAQAYSSTSKSFKESAAFNNWPLKPLDSEAFSI 415 >ref|XP_002320118.2| adenosine-deaminase family protein [Populus trichocarpa] gi|566203135|ref|XP_006375333.1| hypothetical protein POPTR_0014s07720g [Populus trichocarpa] gi|550323730|gb|EEE98433.2| adenosine-deaminase family protein [Populus trichocarpa] gi|550323732|gb|ERP53130.1| hypothetical protein POPTR_0014s07720g [Populus trichocarpa] Length = 404 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/54 (55%), Positives = 34/54 (62%) Frame = +3 Query: 3 LMEGCSSRIQADDISYRELKAGAQEYRSALKILRGSLPFSNWILKPLDLEAFSI 164 L + S+ A DISYRELK AQ Y S K + S F+NW LKPLD EAFSI Sbjct: 348 LKQEFQSKCPAKDISYRELKNNAQAYSSTSKSFKESAAFNNWPLKPLDSEAFSI 401